Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1981790..1982566 | Replicon | chromosome |
| Accession | NZ_CP119338 | ||
| Organism | Staphylococcus aureus strain N09HSA11 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | P1A14_RS09655 | Protein ID | WP_000031108.1 |
| Coordinates | 1981790..1981942 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | P1A14_RS09660 | Protein ID | WP_001251230.1 |
| Coordinates | 1981967..1982566 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A14_RS09640 (P1A14_09640) | 1977705..1978526 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| P1A14_RS09645 (P1A14_09645) | 1978978..1980363 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
| P1A14_RS09650 (P1A14_09650) | 1980559..1980954 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| P1A14_RS09655 (P1A14_09655) | 1981790..1981942 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| P1A14_RS09660 (P1A14_09660) | 1981967..1982566 | - | 600 | WP_001251230.1 | hypothetical protein | Antitoxin |
| P1A14_RS09665 (P1A14_09665) | 1982725..1983195 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| P1A14_RS09670 (P1A14_09670) | 1983200..1984327 | - | 1128 | WP_031590038.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| P1A14_RS09675 (P1A14_09675) | 1984478..1985200 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| P1A14_RS09680 (P1A14_09680) | 1985193..1986650 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T273982 WP_000031108.1 NZ_CP119338:c1981942-1981790 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22369.51 Da Isoelectric Point: 4.9728
>AT273982 WP_001251230.1 NZ_CP119338:c1982566-1981967 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|