Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1911001..1911560 Replicon chromosome
Accession NZ_CP119334
Organism Vibrio alginolyticus strain 2-1

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag PY250_RS08740 Protein ID WP_005398411.1
Coordinates 1911282..1911560 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PY250_RS08735 Protein ID WP_005398409.1
Coordinates 1911001..1911285 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY250_RS08685 (PY250_08685) 1906588..1907121 - 534 WP_213904965.1 cysteine hydrolase family protein -
PY250_RS08690 (PY250_08690) 1907151..1907243 - 93 WP_005534950.1 DUF3265 domain-containing protein -
PY250_RS08695 (PY250_08695) 1907258..1907770 - 513 WP_213904964.1 hypothetical protein -
PY250_RS08700 (PY250_08700) 1908365..1908817 - 453 WP_275593348.1 VOC family protein -
PY250_RS08705 (PY250_08705) 1909010..1909414 - 405 WP_213904963.1 GFA family protein -
PY250_RS08710 (PY250_08710) 1909448..1909594 - 147 WP_275593542.1 DUF3265 domain-containing protein -
PY250_RS08715 (PY250_08715) 1909555..1909944 - 390 WP_050935661.1 DUF4345 domain-containing protein -
PY250_RS08720 (PY250_08720) 1909984..1910076 - 93 WP_004748931.1 DUF3265 domain-containing protein -
PY250_RS08725 (PY250_08725) 1910096..1910806 - 711 WP_086495586.1 hypothetical protein -
PY250_RS08730 (PY250_08730) 1910833..1910924 - 92 Protein_1690 DUF3265 domain-containing protein -
PY250_RS08735 (PY250_08735) 1911001..1911285 + 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PY250_RS08740 (PY250_08740) 1911282..1911560 + 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PY250_RS08745 (PY250_08745) 1911589..1911678 - 90 WP_213904989.1 DUF3265 domain-containing protein -
PY250_RS08750 (PY250_08750) 1911685..1912338 - 654 WP_213904961.1 hypothetical protein -
PY250_RS08755 (PY250_08755) 1912367..1912459 - 93 WP_072612521.1 DUF3265 domain-containing protein -
PY250_RS08760 (PY250_08760) 1912474..1912824 - 351 WP_213904960.1 nucleotide pyrophosphohydrolase -
PY250_RS08765 (PY250_08765) 1912874..1912966 - 93 WP_202988207.1 DUF3265 domain-containing protein -
PY250_RS08770 (PY250_08770) 1913497..1913589 - 93 WP_079751545.1 DUF3265 domain-containing protein -
PY250_RS08775 (PY250_08775) 1913604..1913951 - 348 WP_031780756.1 hypothetical protein -
PY250_RS08780 (PY250_08780) 1913991..1914080 - 90 WP_275593543.1 DUF3265 domain-containing protein -
PY250_RS08785 (PY250_08785) 1914098..1915096 - 999 WP_085570170.1 alpha/beta fold hydrolase -
PY250_RS08790 (PY250_08790) 1915278..1916165 - 888 WP_275593349.1 hypothetical protein -
PY250_RS08795 (PY250_08795) 1916196..1916285 - 90 WP_079880741.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1891286..1948300 57014
- inside Integron - - 1901445..1947182 45737


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273978 WP_005398411.1 NZ_CP119334:1911282-1911560 [Vibrio alginolyticus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273978 WP_005398409.1 NZ_CP119334:1911001-1911285 [Vibrio alginolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References