Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1902938..1903466 | Replicon | chromosome |
| Accession | NZ_CP119334 | ||
| Organism | Vibrio alginolyticus strain 2-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PY250_RS08645 | Protein ID | WP_042524283.1 |
| Coordinates | 1903176..1903466 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A347UR02 |
| Locus tag | PY250_RS08640 | Protein ID | WP_005377003.1 |
| Coordinates | 1902938..1903186 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY250_RS08595 (PY250_08595) | 1898587..1898988 | - | 402 | WP_053306978.1 | DUF2007 domain-containing protein | - |
| PY250_RS08600 (PY250_08600) | 1899093..1899614 | - | 522 | WP_065274603.1 | GNAT family N-acetyltransferase | - |
| PY250_RS08605 (PY250_08605) | 1899757..1900128 | - | 372 | WP_132937087.1 | hypothetical protein | - |
| PY250_RS08610 (PY250_08610) | 1900289..1900864 | - | 576 | WP_132937086.1 | hypothetical protein | - |
| PY250_RS08615 (PY250_08615) | 1900909..1901037 | - | 129 | WP_158157402.1 | DUF3265 domain-containing protein | - |
| PY250_RS08620 (PY250_08620) | 1901583..1901999 | - | 417 | WP_047104489.1 | lysozyme inhibitor LprI family protein | - |
| PY250_RS08625 (PY250_08625) | 1902029..1902121 | - | 93 | WP_086485338.1 | DUF3265 domain-containing protein | - |
| PY250_RS08630 (PY250_08630) | 1902145..1902744 | - | 600 | WP_054866200.1 | hypothetical protein | - |
| PY250_RS08635 (PY250_08635) | 1902795..1902881 | - | 87 | WP_225492314.1 | DUF3265 domain-containing protein | - |
| PY250_RS08640 (PY250_08640) | 1902938..1903186 | + | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PY250_RS08645 (PY250_08645) | 1903176..1903466 | + | 291 | WP_042524283.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PY250_RS08650 (PY250_08650) | 1903613..1904008 | - | 396 | WP_042524285.1 | ACT domain-containing protein | - |
| PY250_RS08655 (PY250_08655) | 1904094..1904171 | - | 78 | Protein_1675 | DUF3265 domain-containing protein | - |
| PY250_RS08660 (PY250_08660) | 1904251..1904439 | - | 189 | WP_225495367.1 | hypothetical protein | - |
| PY250_RS08665 (PY250_08665) | 1904704..1904769 | - | 66 | Protein_1677 | DUF3265 domain-containing protein | - |
| PY250_RS08670 (PY250_08670) | 1905184..1905276 | - | 93 | WP_213904966.1 | DUF3265 domain-containing protein | - |
| PY250_RS08675 (PY250_08675) | 1905302..1905898 | - | 597 | WP_275593347.1 | DJ-1/PfpI family protein | - |
| PY250_RS08680 (PY250_08680) | 1905926..1906055 | - | 130 | Protein_1680 | DUF3265 domain-containing protein | - |
| PY250_RS08685 (PY250_08685) | 1906588..1907121 | - | 534 | WP_213904965.1 | cysteine hydrolase family protein | - |
| PY250_RS08690 (PY250_08690) | 1907151..1907243 | - | 93 | WP_005534950.1 | DUF3265 domain-containing protein | - |
| PY250_RS08695 (PY250_08695) | 1907258..1907770 | - | 513 | WP_213904964.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1891286..1948300 | 57014 | |
| - | inside | Integron | - | - | 1901445..1947182 | 45737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11291.28 Da Isoelectric Point: 10.5932
>T273977 WP_042524283.1 NZ_CP119334:1903176-1903466 [Vibrio alginolyticus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSSYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSSYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|