Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3736910..3737529 Replicon chromosome
Accession NZ_CP119332
Organism Klebsiella pneumoniae strain CQ22WZ0036

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OMP07_RS18740 Protein ID WP_002892050.1
Coordinates 3737311..3737529 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OMP07_RS18735 Protein ID WP_002892066.1
Coordinates 3736910..3737284 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMP07_RS18725 (OMP07_18725) 3732062..3733255 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OMP07_RS18730 (OMP07_18730) 3733278..3736424 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OMP07_RS18735 (OMP07_18735) 3736910..3737284 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OMP07_RS18740 (OMP07_18740) 3737311..3737529 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OMP07_RS18745 (OMP07_18745) 3737688..3738254 + 567 WP_002892030.1 maltose O-acetyltransferase -
OMP07_RS18750 (OMP07_18750) 3738226..3738366 - 141 WP_004147370.1 hypothetical protein -
OMP07_RS18755 (OMP07_18755) 3738387..3738857 + 471 WP_002892026.1 YlaC family protein -
OMP07_RS18760 (OMP07_18760) 3738832..3740283 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OMP07_RS18765 (OMP07_18765) 3740384..3741082 + 699 WP_002892021.1 GNAT family protein -
OMP07_RS18770 (OMP07_18770) 3741079..3741219 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OMP07_RS18775 (OMP07_18775) 3741219..3741482 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273962 WP_002892050.1 NZ_CP119332:3737311-3737529 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273962 WP_002892066.1 NZ_CP119332:3736910-3737284 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References