Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3736910..3737529 | Replicon | chromosome |
| Accession | NZ_CP119332 | ||
| Organism | Klebsiella pneumoniae strain CQ22WZ0036 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OMP07_RS18740 | Protein ID | WP_002892050.1 |
| Coordinates | 3737311..3737529 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | OMP07_RS18735 | Protein ID | WP_002892066.1 |
| Coordinates | 3736910..3737284 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMP07_RS18725 (OMP07_18725) | 3732062..3733255 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OMP07_RS18730 (OMP07_18730) | 3733278..3736424 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OMP07_RS18735 (OMP07_18735) | 3736910..3737284 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| OMP07_RS18740 (OMP07_18740) | 3737311..3737529 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OMP07_RS18745 (OMP07_18745) | 3737688..3738254 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| OMP07_RS18750 (OMP07_18750) | 3738226..3738366 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| OMP07_RS18755 (OMP07_18755) | 3738387..3738857 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| OMP07_RS18760 (OMP07_18760) | 3738832..3740283 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| OMP07_RS18765 (OMP07_18765) | 3740384..3741082 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| OMP07_RS18770 (OMP07_18770) | 3741079..3741219 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OMP07_RS18775 (OMP07_18775) | 3741219..3741482 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273962 WP_002892050.1 NZ_CP119332:3737311-3737529 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT273962 WP_002892066.1 NZ_CP119332:3736910-3737284 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |