273954

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1994733..1995204 Replicon chromosome
Accession NZ_CP119327
Organism Staphylococcus sp. NRL 16/872

Toxin (Protein)


Gene name TsaT Uniprot ID -
Locus tag MT340_RS09960 Protein ID WP_243589808.1
Coordinates 1995016..1995204 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag MT340_RS09955 Protein ID WP_243589807.1
Coordinates 1994733..1994990 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT340_RS09920 (MT340_009920) 1989958..1990683 - 726 WP_243589800.1 type I 3-dehydroquinate dehydratase -
MT340_RS09925 (MT340_009925) 1990856..1991278 + 423 WP_243589801.1 organic hydroperoxide resistance protein -
MT340_RS09930 (MT340_009930) 1991528..1992019 + 492 WP_243589802.1 GNAT family N-acetyltransferase -
MT340_RS09935 (MT340_009935) 1992163..1992783 + 621 WP_243589803.1 LysE family transporter -
MT340_RS09940 (MT340_009940) 1992869..1993462 - 594 WP_243589804.1 histidine phosphatase family protein -
MT340_RS09945 (MT340_009945) 1993739..1993981 + 243 WP_243589805.1 hypothetical protein -
MT340_RS09950 (MT340_009950) 1993973..1994176 - 204 WP_243589806.1 sterile alpha motif-like domain-containing protein -
MT340_RS09955 (MT340_009955) 1994733..1994990 + 258 WP_243589807.1 hypothetical protein Antitoxin
MT340_RS09960 (MT340_009960) 1995016..1995204 + 189 WP_243589808.1 hypothetical protein Toxin
MT340_RS09965 (MT340_009965) 1995297..1995872 + 576 WP_243589809.1 lipoprotein N-acylation protein LnsA -
MT340_RS09970 (MT340_009970) 1995971..1996207 - 237 WP_243589810.1 hypothetical protein -
MT340_RS09975 (MT340_009975) 1996392..1997000 - 609 WP_243589811.1 GNAT family N-acetyltransferase -
MT340_RS09980 (MT340_009980) 1997146..1997892 + 747 WP_243589812.1 poly-gamma-glutamate hydrolase family protein -
MT340_RS09985 (MT340_009985) 1997984..1998271 + 288 WP_243589813.1 hypothetical protein -
MT340_RS09990 (MT340_009990) 1998331..1998552 + 222 WP_243589814.1 hypothetical protein -
MT340_RS09995 (MT340_009995) 1998708..1999544 + 837 WP_243589815.1 hypothetical protein -
MT340_RS10000 (MT340_010000) 1999711..1999887 + 177 WP_243589816.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7070.69 Da        Isoelectric Point: 9.6269

>T273954 WP_243589808.1 NZ_CP119327:1995016-1995204 [Staphylococcus sp. NRL 16/872]
MSTHLTILLWLGIFFVIAASIILGLLLKSKKDERKESYLGFTVVFYIFGFALLIYVLIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9899.97 Da        Isoelectric Point: 5.9855

>AT273954 WP_243589807.1 NZ_CP119327:1994733-1994990 [Staphylococcus sp. NRL 16/872]
MNSSKLFWFNIVMTIAFLGFNIIVTYYPKLDDFFWLIPGLIVSSVTIIISLSTATICKNLISEVIFLINIVLLLYYVYPI
IYNFF

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References