Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
Location | 1040101..1040903 | Replicon | chromosome |
Accession | NZ_CP119327 | ||
Organism | Staphylococcus sp. NRL 16/872 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | MT340_RS05185 | Protein ID | WP_243589039.1 |
Coordinates | 1040101..1040562 (-) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | MT340_RS05190 | Protein ID | WP_243589040.1 |
Coordinates | 1040574..1040903 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT340_RS05130 (MT340_005130) | 1036133..1036693 | + | 561 | WP_243603619.1 | alpha/beta hydrolase | - |
MT340_RS05175 (MT340_005175) | 1038050..1039099 | - | 1050 | WP_243589037.1 | site-specific integrase | - |
MT340_RS05180 (MT340_005180) | 1039163..1040080 | - | 918 | WP_243589038.1 | DUF5067 domain-containing protein | - |
MT340_RS05185 (MT340_005185) | 1040101..1040562 | - | 462 | WP_243589039.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
MT340_RS05190 (MT340_005190) | 1040574..1040903 | - | 330 | WP_243589040.1 | helix-turn-helix transcriptional regulator | Antitoxin |
MT340_RS05195 (MT340_005195) | 1041097..1041336 | + | 240 | WP_002484756.1 | helix-turn-helix transcriptional regulator | - |
MT340_RS05200 (MT340_005200) | 1041354..1042283 | + | 930 | WP_243589041.1 | DUF3102 domain-containing protein | - |
MT340_RS05205 (MT340_005205) | 1042276..1042815 | + | 540 | WP_243589042.1 | ORF6C domain-containing protein | - |
MT340_RS05210 (MT340_005210) | 1042853..1043014 | + | 162 | WP_012991008.1 | hypothetical protein | - |
MT340_RS05215 (MT340_005215) | 1043007..1043252 | - | 246 | WP_243589043.1 | hypothetical protein | - |
MT340_RS05220 (MT340_005220) | 1043306..1043515 | + | 210 | WP_243589044.1 | hypothetical protein | - |
MT340_RS05225 (MT340_005225) | 1043529..1043690 | + | 162 | WP_243589045.1 | DUF1270 family protein | - |
MT340_RS05230 (MT340_005230) | 1043775..1044008 | + | 234 | WP_243589046.1 | hypothetical protein | - |
MT340_RS05235 (MT340_005235) | 1043992..1044477 | + | 486 | WP_243589047.1 | siphovirus Gp157 family protein | - |
MT340_RS05240 (MT340_005240) | 1044478..1045155 | + | 678 | WP_243589048.1 | ERF family protein | - |
MT340_RS05245 (MT340_005245) | 1045148..1045561 | + | 414 | WP_193624733.1 | single-stranded DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1036133..1083253 | 47120 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18115.68 Da Isoelectric Point: 6.4974
>T273953 WP_243589039.1 NZ_CP119327:c1040562-1040101 [Staphylococcus sp. NRL 16/872]
MGLYEKMLIEHDYIEVRETDVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELAHHKLTYGNILDQSKDINRKFENYAR
RHGYEAALPLRIIVEAHNYGVSSLYELADYVQLSEKYIVEILEHYKNKYGIGTHYGNYSITFEPLRVFKYSKI
MGLYEKMLIEHDYIEVRETDVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELAHHKLTYGNILDQSKDINRKFENYAR
RHGYEAALPLRIIVEAHNYGVSSLYELADYVQLSEKYIVEILEHYKNKYGIGTHYGNYSITFEPLRVFKYSKI
Download Length: 462 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 12698.31 Da Isoelectric Point: 6.2406
>AT273953 WP_243589040.1 NZ_CP119327:c1040903-1040574 [Staphylococcus sp. NRL 16/872]
MRNNDEIITIIKSAMKEQDMSLSELARRVGVAKSAVSRYLNLTREFPLNRSEDFAKALSISTEYLLGFDKSEQQHEQPLH
RAAHLEGELTDDEWQRVLDYADFIRSKRK
MRNNDEIITIIKSAMKEQDMSLSELARRVGVAKSAVSRYLNLTREFPLNRSEDFAKALSISTEYLLGFDKSEQQHEQPLH
RAAHLEGELTDDEWQRVLDYADFIRSKRK
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|