Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1013196..1013991 | Replicon | chromosome |
Accession | NZ_CP119327 | ||
Organism | Staphylococcus sp. NRL 16/872 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | MT340_RS05020 | Protein ID | WP_243589016.1 |
Coordinates | 1013818..1013991 (+) | Length | 58 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | MT340_RS05015 | Protein ID | WP_243589015.1 |
Coordinates | 1013196..1013795 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT340_RS04995 (MT340_004995) | 1009087..1010541 | + | 1455 | WP_243589011.1 | ABC transporter substrate-binding protein/permease | - |
MT340_RS05000 (MT340_005000) | 1010534..1011256 | + | 723 | WP_243589012.1 | amino acid ABC transporter ATP-binding protein | - |
MT340_RS05005 (MT340_005005) | 1011417..1012544 | + | 1128 | WP_243589013.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
MT340_RS05010 (MT340_005010) | 1012545..1013015 | + | 471 | WP_243589014.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
MT340_RS05015 (MT340_005015) | 1013196..1013795 | + | 600 | WP_243589015.1 | glucosamine-6-phosphate isomerase | Antitoxin |
MT340_RS05020 (MT340_005020) | 1013818..1013991 | + | 174 | WP_243589016.1 | SAS053 family protein | Toxin |
MT340_RS05025 (MT340_005025) | 1014172..1014564 | + | 393 | WP_243589017.1 | hypothetical protein | - |
MT340_RS05030 (MT340_005030) | 1014701..1016086 | + | 1386 | WP_243589018.1 | class II fumarate hydratase | - |
MT340_RS05035 (MT340_005035) | 1016149..1016970 | - | 822 | WP_243603614.1 | RluA family pseudouridine synthase | - |
MT340_RS05040 (MT340_005040) | 1017182..1018297 | + | 1116 | WP_243589020.1 | GAF domain-containing sensor histidine kinase | - |
MT340_RS05045 (MT340_005045) | 1018316..1018939 | + | 624 | WP_243589021.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6726.17 Da Isoelectric Point: 3.9487
>T273952 WP_243589016.1 NZ_CP119327:1013818-1013991 [Staphylococcus sp. NRL 16/872]
MSDKKETELNYHEEENAMVQDLDDLKELGKEMEQISEKNDEEKLNQSHDSDVRSDLD
MSDKKETELNYHEEENAMVQDLDDLKELGKEMEQISEKNDEEKLNQSHDSDVRSDLD
Download Length: 174 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22463.45 Da Isoelectric Point: 4.8518
>AT273952 WP_243589015.1 NZ_CP119327:1013196-1013795 [Staphylococcus sp. NRL 16/872]
MAMNFKVFNDVDQVAQFTADIIRKQFNNNPTTIAGLHLERETAPVLDELKKDVDRNPVDFSQVNILDYDDNRSYYEALGV
PSGQIYPINLDDDATSLIDDKIKTKENKGKLILQVTSIDEKGSLNVNIRQGLMKAREVVLVITGGQKREFVKKLYEENGK
SSFEPADLKVHRMVTVVLDRAAAEGLPEDVKEYFTAHFA
MAMNFKVFNDVDQVAQFTADIIRKQFNNNPTTIAGLHLERETAPVLDELKKDVDRNPVDFSQVNILDYDDNRSYYEALGV
PSGQIYPINLDDDATSLIDDKIKTKENKGKLILQVTSIDEKGSLNVNIRQGLMKAREVVLVITGGQKREFVKKLYEENGK
SSFEPADLKVHRMVTVVLDRAAAEGLPEDVKEYFTAHFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|