Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 878051..878580 | Replicon | chromosome |
| Accession | NZ_CP119327 | ||
| Organism | Staphylococcus sp. NRL 16/872 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | MT340_RS04235 | Protein ID | WP_243588914.1 |
| Coordinates | 878218..878580 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | MT340_RS04230 | Protein ID | WP_243588913.1 |
| Coordinates | 878051..878221 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT340_RS04205 (MT340_004205) | 873869..874348 | + | 480 | WP_243588909.1 | PH domain-containing protein | - |
| MT340_RS04210 (MT340_004210) | 874341..875867 | + | 1527 | WP_243588910.1 | PH domain-containing protein | - |
| MT340_RS04215 (MT340_004215) | 875860..876354 | + | 495 | WP_243603600.1 | PH domain-containing protein | - |
| MT340_RS04220 (MT340_004220) | 876375..876734 | + | 360 | WP_243588911.1 | holo-ACP synthase | - |
| MT340_RS04225 (MT340_004225) | 876816..877964 | + | 1149 | WP_243588912.1 | alanine racemase | - |
| MT340_RS04230 (MT340_004230) | 878051..878221 | + | 171 | WP_243588913.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| MT340_RS04235 (MT340_004235) | 878218..878580 | + | 363 | WP_243588914.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| MT340_RS04240 (MT340_004240) | 878894..879895 | + | 1002 | WP_243588915.1 | PP2C family protein-serine/threonine phosphatase | - |
| MT340_RS04245 (MT340_004245) | 879987..880313 | + | 327 | WP_243588916.1 | anti-sigma factor antagonist | - |
| MT340_RS04250 (MT340_004250) | 880339..880791 | + | 453 | WP_243590233.1 | anti-sigma B factor RsbW | - |
| MT340_RS04255 (MT340_004255) | 880766..881536 | + | 771 | WP_243588917.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13618.79 Da Isoelectric Point: 9.6742
>T273951 WP_243588914.1 NZ_CP119327:878218-878580 [Staphylococcus sp. NRL 16/872]
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYRLDRDSVILLEQIR
TLDKKRLKEKLTYLSEEKMKEVDEALDISLGLHEVRPQKT
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYRLDRDSVILLEQIR
TLDKKRLKEKLTYLSEEKMKEVDEALDISLGLHEVRPQKT
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|