Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
Location | 4675643..4676376 | Replicon | chromosome |
Accession | NZ_CP119319 | ||
Organism | MAG: Kluyvera intermedia isolate MAG 4159 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | P0Y47_RS21580 | Protein ID | WP_279216165.1 |
Coordinates | 4675643..4675972 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | P0Y47_RS21585 | Protein ID | WP_279216166.1 |
Coordinates | 4676011..4676376 (-) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0Y47_RS21560 (4670985) | 4670985..4671995 | - | 1011 | WP_279216162.1 | ABC transporter substrate-binding protein | - |
P0Y47_RS21565 (4672008) | 4672008..4674134 | - | 2127 | WP_279216163.1 | TonB-dependent siderophore receptor | - |
P0Y47_RS21570 (4674361) | 4674361..4674783 | - | 423 | WP_279216164.1 | hypothetical protein | - |
P0Y47_RS21575 (4674941) | 4674941..4675183 | - | 243 | WP_153742334.1 | DinI family protein | - |
P0Y47_RS21580 (4675643) | 4675643..4675972 | - | 330 | WP_279216165.1 | TA system toxin CbtA family protein | Toxin |
P0Y47_RS21585 (4676011) | 4676011..4676376 | - | 366 | WP_279216166.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P0Y47_RS21590 (4676402) | 4676402..4676623 | - | 222 | WP_032680445.1 | DUF987 domain-containing protein | - |
P0Y47_RS21595 (4676620) | 4676620..4677162 | - | 543 | WP_279216167.1 | DNA repair protein RadC | - |
P0Y47_RS21600 (4677175) | 4677175..4677618 | - | 444 | WP_279216168.1 | antirestriction protein | - |
P0Y47_RS21605 (4677649) | 4677649..4678473 | - | 825 | WP_279216169.1 | DUF932 domain-containing protein | - |
P0Y47_RS21610 (4679148) | 4679148..4679987 | - | 840 | WP_279216170.1 | hypothetical protein | - |
P0Y47_RS21615 (4680073) | 4680073..4680486 | - | 414 | WP_279216171.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12406.21 Da Isoelectric Point: 9.6273
>T273949 WP_279216165.1 NZ_CP119319:c4675972-4675643 [Kluyvera intermedia]
MQTISSHPTRATQPCLSPVEIWQRLLTHLLSQHYGLTLNDTPFSNKTTIQEHIDAGISLSDAVNFLVEKYGLIRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
MQTISSHPTRATQPCLSPVEIWQRLLTHLLSQHYGLTLNDTPFSNKTTIQEHIDAGISLSDAVNFLVEKYGLIRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13553.35 Da Isoelectric Point: 5.0950
>AT273949 WP_279216166.1 NZ_CP119319:c4676376-4676011 [Kluyvera intermedia]
MNNRSESGTKPENPACQLWGLKRAVTPCFGARLVQEGNRVHFLADRAGFHGAFSDDEALYLDQAFPLMLKQLELMLISGE
LNPRYQHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
MNNRSESGTKPENPACQLWGLKRAVTPCFGARLVQEGNRVHFLADRAGFHGAFSDDEALYLDQAFPLMLKQLELMLISGE
LNPRYQHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|