Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4414231..4414894 | Replicon | chromosome |
Accession | NZ_CP119319 | ||
Organism | MAG: Kluyvera intermedia isolate MAG 4159 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3S4EYA3 |
Locus tag | P0Y47_RS20350 | Protein ID | WP_062773047.1 |
Coordinates | 4414478..4414894 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A3S4FV25 |
Locus tag | P0Y47_RS20345 | Protein ID | WP_062773044.1 |
Coordinates | 4414231..4414497 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0Y47_RS20320 (4409626) | 4409626..4410360 | - | 735 | WP_073971084.1 | MurR/RpiR family transcriptional regulator | - |
P0Y47_RS20325 (4410406) | 4410406..4410720 | + | 315 | WP_062773034.1 | N(4)-acetylcytidine aminohydrolase | - |
P0Y47_RS20330 (4410879) | 4410879..4411541 | + | 663 | WP_279216061.1 | hemolysin III family protein | - |
P0Y47_RS20335 (4411787) | 4411787..4412914 | + | 1128 | WP_279216062.1 | IS481 family transposase | - |
P0Y47_RS20340 (4413000) | 4413000..4413983 | - | 984 | WP_153742213.1 | tRNA-modifying protein YgfZ | - |
P0Y47_RS20345 (4414231) | 4414231..4414497 | + | 267 | WP_062773044.1 | FAD assembly factor SdhE | Antitoxin |
P0Y47_RS20350 (4414478) | 4414478..4414894 | + | 417 | WP_062773047.1 | protein YgfX | Toxin |
P0Y47_RS20355 (4414891) | 4414891..4415412 | - | 522 | WP_153744004.1 | flavodoxin FldB | - |
P0Y47_RS20360 (4415515) | 4415515..4416411 | + | 897 | WP_062773053.1 | site-specific tyrosine recombinase XerD | - |
P0Y47_RS20365 (4416433) | 4416433..4417146 | + | 714 | WP_062773056.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P0Y47_RS20370 (4417152) | 4417152..4418885 | + | 1734 | WP_062773059.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16416.32 Da Isoelectric Point: 11.6889
>T273948 WP_062773047.1 NZ_CP119319:4414478-4414894 [Kluyvera intermedia]
VVLWQSDLRVSWRSQWLSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSLVVFDCVRSQRRIHSHQGEIKLLMDSRLRWRNQ
EWDILGTPWMLSSGMMLRIRRCDGGRRQHLWLAADSMNAQEWRDLRRILLQQPAPGQH
VVLWQSDLRVSWRSQWLSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSLVVFDCVRSQRRIHSHQGEIKLLMDSRLRWRNQ
EWDILGTPWMLSSGMMLRIRRCDGGRRQHLWLAADSMNAQEWRDLRRILLQQPAPGQH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S4EYA3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S4FV25 |