Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2318661..2319279 | Replicon | chromosome |
Accession | NZ_CP119319 | ||
Organism | MAG: Kluyvera intermedia isolate MAG 4159 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A447MKF0 |
Locus tag | P0Y47_RS10685 | Protein ID | WP_062773821.1 |
Coordinates | 2319061..2319279 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | P0Y47_RS10680 | Protein ID | WP_153743488.1 |
Coordinates | 2318661..2319035 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0Y47_RS10670 (2313747) | 2313747..2314943 | + | 1197 | WP_279217154.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P0Y47_RS10675 (2314966) | 2314966..2318112 | + | 3147 | WP_153743487.1 | multidrug efflux RND transporter permease subunit AcrB | - |
P0Y47_RS10680 (2318661) | 2318661..2319035 | + | 375 | WP_153743488.1 | Hha toxicity modulator TomB | Antitoxin |
P0Y47_RS10685 (2319061) | 2319061..2319279 | + | 219 | WP_062773821.1 | HHA domain-containing protein | Toxin |
P0Y47_RS10690 (2319420) | 2319420..2319974 | + | 555 | WP_279217155.1 | maltose O-acetyltransferase | - |
P0Y47_RS10695 (2320078) | 2320078..2320548 | + | 471 | WP_062774064.1 | YlaC family protein | - |
P0Y47_RS10700 (2320523) | 2320523..2321968 | - | 1446 | WP_279217156.1 | PLP-dependent aminotransferase family protein | - |
P0Y47_RS10705 (2322071) | 2322071..2322781 | + | 711 | WP_279217157.1 | GNAT family protein | - |
P0Y47_RS10710 (2322778) | 2322778..2322918 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
P0Y47_RS10715 (2322918) | 2322918..2323181 | - | 264 | WP_052283831.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8624.01 Da Isoelectric Point: 8.9008
>T273946 WP_062773821.1 NZ_CP119319:2319061-2319279 [Kluyvera intermedia]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPTVWKFIR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPTVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14325.07 Da Isoelectric Point: 4.8887
>AT273946 WP_153743488.1 NZ_CP119319:2318661-2319035 [Kluyvera intermedia]
MDEYSPKRHDIAQLKFLCETLYHDSLATLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYSEDNKLIAQIDEYL
DDTFMLFGNYGINSDDLQKWRKSGNKLFRCFVNASRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDSLATLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYSEDNKLIAQIDEYL
DDTFMLFGNYGINSDDLQKWRKSGNKLFRCFVNASRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|