Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 252884..253526 | Replicon | chromosome |
| Accession | NZ_CP119300 | ||
| Organism | Bacillus cereus strain M72-4 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | PZ893_RS01415 | Protein ID | WP_000635963.1 |
| Coordinates | 253176..253526 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | PZ893_RS01410 | Protein ID | WP_000004570.1 |
| Coordinates | 252884..253171 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZ893_RS01385 (PZ893_01385) | 248201..249163 | + | 963 | WP_000961165.1 | UV DNA damage repair endonuclease UvsE | - |
| PZ893_RS01390 (PZ893_01390) | 249156..249728 | - | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
| PZ893_RS01395 (PZ893_01395) | 249822..250181 | + | 360 | WP_000583416.1 | holo-ACP synthase | - |
| PZ893_RS01400 (PZ893_01400) | 250338..251288 | + | 951 | WP_002004297.1 | outer membrane lipoprotein carrier protein LolA | - |
| PZ893_RS01405 (PZ893_01405) | 251406..252575 | + | 1170 | WP_000390615.1 | alanine racemase | - |
| PZ893_RS01410 (PZ893_01410) | 252884..253171 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| PZ893_RS01415 (PZ893_01415) | 253176..253526 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PZ893_RS01420 (PZ893_01420) | 253594..255762 | + | 2169 | WP_000426242.1 | Tex family protein | - |
| PZ893_RS01425 (PZ893_01425) | 255820..255936 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| PZ893_RS01430 (PZ893_01430) | 256132..256590 | + | 459 | WP_000344234.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T273939 WP_000635963.1 NZ_CP119300:253176-253526 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |