Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 165493..165998 | Replicon | chromosome |
Accession | NZ_CP119298 | ||
Organism | Pseudomonas aeruginosa strain SNDPR-01 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | PZ484_RS00770 | Protein ID | WP_003121619.1 |
Coordinates | 165493..165774 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | PZ484_RS00775 | Protein ID | WP_003112628.1 |
Coordinates | 165771..165998 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZ484_RS00745 | 160744..162093 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
PZ484_RS00750 | 162142..162828 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PZ484_RS00755 | 162929..163663 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PZ484_RS00760 | 163843..164253 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PZ484_RS00765 | 164285..165193 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
PZ484_RS00770 | 165493..165774 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PZ484_RS00775 | 165771..165998 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PZ484_RS00780 | 166174..166794 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PZ484_RS00785 | 166895..167395 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
PZ484_RS00790 | 167468..167809 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PZ484_RS00795 | 167891..169318 | - | 1428 | WP_003083784.1 | GABA permease | - |
PZ484_RS00800 | 169487..170980 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T273934 WP_003121619.1 NZ_CP119298:c165774-165493 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I707 |