Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-MqsA |
| Location | 3657184..3657883 | Replicon | chromosome |
| Accession | NZ_CP119297 | ||
| Organism | Proteus mirabilis strain HK294 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P1A26_RS16950 | Protein ID | WP_017628658.1 |
| Coordinates | 3657184..3657570 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | B4EZ97 |
| Locus tag | P1A26_RS16955 | Protein ID | WP_004246828.1 |
| Coordinates | 3657563..3657883 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A26_RS16935 (P1A26_16935) | 3653203..3653784 | - | 582 | WP_012368524.1 | DNA-3-methyladenine glycosylase I | - |
| P1A26_RS16940 (P1A26_16940) | 3654035..3654940 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
| P1A26_RS16945 (P1A26_16945) | 3654950..3657022 | + | 2073 | WP_017628659.1 | glycine--tRNA ligase subunit beta | - |
| P1A26_RS16950 (P1A26_16950) | 3657184..3657570 | + | 387 | WP_017628658.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P1A26_RS16955 (P1A26_16955) | 3657563..3657883 | + | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
| P1A26_RS16960 (P1A26_16960) | 3657932..3658366 | - | 435 | WP_004246827.1 | hypothetical protein | - |
| P1A26_RS16965 (P1A26_16965) | 3658359..3659243 | - | 885 | WP_012368526.1 | endonuclease/exonuclease/phosphatase family protein | - |
| P1A26_RS16970 (P1A26_16970) | 3659458..3660744 | - | 1287 | WP_063073863.1 | DUF3748 domain-containing protein | - |
| P1A26_RS16975 (P1A26_16975) | 3660881..3661498 | + | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
| P1A26_RS16980 (P1A26_16980) | 3661799..3662422 | + | 624 | WP_004246821.1 | guanylate kinase | - |
| P1A26_RS16985 (P1A26_16985) | 3662477..3662752 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14322.65 Da Isoelectric Point: 10.0826
>T273932 WP_017628658.1 NZ_CP119297:3657184-3657570 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVRYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVRYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|