Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1722801..1723600 | Replicon | chromosome |
| Accession | NZ_CP119297 | ||
| Organism | Proteus mirabilis strain HK294 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | A0A8E3RD10 |
| Locus tag | P1A26_RS08295 | Protein ID | WP_004247966.1 |
| Coordinates | 1723076..1723600 (+) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | B4EVS2 |
| Locus tag | P1A26_RS08290 | Protein ID | WP_004247964.1 |
| Coordinates | 1722801..1723079 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A26_RS08265 (P1A26_08265) | 1718151..1719233 | + | 1083 | WP_004242680.1 | peptide chain release factor 1 | - |
| P1A26_RS08270 (P1A26_08270) | 1719233..1720081 | + | 849 | WP_004247962.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| P1A26_RS08275 (P1A26_08275) | 1720059..1720874 | + | 816 | WP_004242688.1 | invasion regulator SirB1 | - |
| P1A26_RS08280 (P1A26_08280) | 1720932..1721786 | + | 855 | WP_004242689.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| P1A26_RS08285 (P1A26_08285) | 1721794..1722723 | + | 930 | WP_017628160.1 | TIGR01212 family radical SAM protein | - |
| P1A26_RS08290 (P1A26_08290) | 1722801..1723079 | + | 279 | WP_004247964.1 | DUF1778 domain-containing protein | Antitoxin |
| P1A26_RS08295 (P1A26_08295) | 1723076..1723600 | + | 525 | WP_004247966.1 | hypothetical protein | Toxin |
| P1A26_RS08300 (P1A26_08300) | 1723681..1725381 | - | 1701 | WP_017628159.1 | C4-dicarboxylic acid transporter DauA | - |
| P1A26_RS08310 (P1A26_08310) | 1726345..1727286 | + | 942 | WP_275621986.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19192.12 Da Isoelectric Point: 9.3561
>T273929 WP_004247966.1 NZ_CP119297:1723076-1723600 [Proteus mirabilis]
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|