Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1529716..1530361 Replicon chromosome
Accession NZ_CP119297
Organism Proteus mirabilis strain HK294

Toxin (Protein)


Gene name hicA Uniprot ID B4ET86
Locus tag P1A26_RS07355 Protein ID WP_004247035.1
Coordinates 1530176..1530361 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B4ET85
Locus tag P1A26_RS07350 Protein ID WP_004247034.1
Coordinates 1529716..1530129 (-) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1A26_RS07320 (P1A26_07320) 1525269..1525427 - 159 WP_004247025.1 hypothetical protein -
P1A26_RS07325 (P1A26_07325) 1525879..1526055 + 177 WP_004247793.1 hypothetical protein -
P1A26_RS07330 (P1A26_07330) 1526226..1526972 - 747 Protein_1410 methyltransferase domain-containing protein -
P1A26_RS07335 (P1A26_07335) 1527822..1528400 + 579 WP_017628400.1 alpha/beta hydrolase -
P1A26_RS07340 (P1A26_07340) 1528513..1528755 - 243 WP_230458803.1 hypothetical protein -
P1A26_RS07345 (P1A26_07345) 1529120..1529620 - 501 WP_004247032.1 response regulator -
P1A26_RS07350 (P1A26_07350) 1529716..1530129 - 414 WP_004247034.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
P1A26_RS07355 (P1A26_07355) 1530176..1530361 - 186 WP_004247035.1 type II toxin-antitoxin system HicA family toxin Toxin
P1A26_RS07360 (P1A26_07360) 1530467..1530934 + 468 WP_223293438.1 DUF1073 domain-containing protein -
P1A26_RS07365 (P1A26_07365) 1530877..1531245 + 369 WP_223293455.1 DUF1073 domain-containing protein -
P1A26_RS07370 (P1A26_07370) 1531251..1531472 + 222 Protein_1418 hypothetical protein -
P1A26_RS07375 (P1A26_07375) 1531801..1532352 - 552 WP_017628396.1 PH domain-containing protein -
P1A26_RS07380 (P1A26_07380) 1532416..1532730 - 315 WP_017628395.1 hypothetical protein -
P1A26_RS07390 (P1A26_07390) 1533137..1534870 - 1734 WP_017628394.1 LPS biosynthesis-modulating metalloenzyme YejM -
P1A26_RS07395 (P1A26_07395) 1534894..1535121 - 228 WP_004247042.1 YejL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7049.30 Da        Isoelectric Point: 10.9659

>T273928 WP_004247035.1 NZ_CP119297:c1530361-1530176 [Proteus mirabilis]
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN

Download         Length: 186 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 15251.98 Da        Isoelectric Point: 4.3830

>AT273928 WP_004247034.1 NZ_CP119297:c1530129-1529716 [Proteus mirabilis]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB B4ET86

Antitoxin

Source ID Structure
AlphaFold DB B4ET85

References