Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 78682..79210 | Replicon | plasmid pAP54-2 |
Accession | NZ_CP119225 | ||
Organism | Acinetobacter proteolyticus strain AP54 |
Toxin (Protein)
Gene name | relE | Uniprot ID | N9N871 |
Locus tag | PY247_RS23410 | Protein ID | WP_000221358.1 |
Coordinates | 78682..78975 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | N9NWT9 |
Locus tag | PY247_RS23415 | Protein ID | WP_000246755.1 |
Coordinates | 78965..79210 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY247_RS23395 (PY247_23395) | 75755..76981 | + | 1227 | WP_004781038.1 | putative acinetoferrin export transporter ActD | - |
PY247_RS23400 (PY247_23400) | 77092..78024 | + | 933 | WP_275574305.1 | IS5 family transposase | - |
PY247_RS23405 (PY247_23405) | 78224..78553 | + | 330 | WP_004827037.1 | four-helix bundle copper-binding protein | - |
PY247_RS23410 (PY247_23410) | 78682..78975 | - | 294 | WP_000221358.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PY247_RS23415 (PY247_23415) | 78965..79210 | - | 246 | WP_000246755.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PY247_RS23420 (PY247_23420) | 79312..79683 | - | 372 | WP_004726814.1 | hypothetical protein | - |
PY247_RS23425 (PY247_23425) | 79908..80105 | - | 198 | WP_004726812.1 | hypothetical protein | - |
PY247_RS23430 (PY247_23430) | 80185..81117 | - | 933 | WP_004726810.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..107216 | 107216 | |
- | inside | IScluster/Tn | - | - | 77155..94107 | 16952 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11292.52 Da Isoelectric Point: 10.4753
>T273925 WP_000221358.1 NZ_CP119225:c78975-78682 [Acinetobacter proteolyticus]
MTYKLLRHKDFTAEWEKLPVAIRDQFKKKLAKVIEQPHIPKNMLRGDLAGCYKIKLLKAGVRLVYQVKDDQVVILLITVG
KRADSIVYDEAKKRIKD
MTYKLLRHKDFTAEWEKLPVAIRDQFKKKLAKVIEQPHIPKNMLRGDLAGCYKIKLLKAGVRLVYQVKDDQVVILLITVG
KRADSIVYDEAKKRIKD
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A1RKP4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A1RJ80 |