Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1663161..1663800 | Replicon | chromosome |
| Accession | NZ_CP119223 | ||
| Organism | Acinetobacter proteolyticus strain AP54 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PY247_RS07980 | Protein ID | WP_275573924.1 |
| Coordinates | 1663411..1663800 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A829HLN7 |
| Locus tag | PY247_RS07975 | Protein ID | WP_004657712.1 |
| Coordinates | 1663161..1663418 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY247_RS07950 (PY247_07950) | 1658288..1658653 | + | 366 | WP_004641032.1 | 50S ribosomal protein L17 | - |
| PY247_RS07955 (PY247_07955) | 1658814..1659380 | + | 567 | WP_275573923.1 | GNAT family N-acetyltransferase | - |
| PY247_RS07960 (PY247_07960) | 1659639..1661130 | + | 1492 | Protein_1539 | NAD(P)/FAD-dependent oxidoreductase | - |
| PY247_RS07965 (PY247_07965) | 1661255..1661755 | + | 501 | WP_070076004.1 | DUF2059 domain-containing protein | - |
| PY247_RS07970 (PY247_07970) | 1661800..1662972 | - | 1173 | WP_004657709.1 | acyl-CoA dehydrogenase family protein | - |
| PY247_RS07975 (PY247_07975) | 1663161..1663418 | + | 258 | WP_004657712.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| PY247_RS07980 (PY247_07980) | 1663411..1663800 | + | 390 | WP_275573924.1 | hypothetical protein | Toxin |
| PY247_RS07985 (PY247_07985) | 1664008..1664214 | + | 207 | WP_004657716.1 | hypothetical protein | - |
| PY247_RS07990 (PY247_07990) | 1664573..1665714 | + | 1142 | Protein_1545 | hypothetical protein | - |
| PY247_RS07995 (PY247_07995) | 1665791..1666360 | + | 570 | WP_004657724.1 | rhombosortase | - |
| PY247_RS08000 (PY247_08000) | 1666516..1668726 | + | 2211 | Protein_1547 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15694.61 Da Isoelectric Point: 10.2640
>T273921 WP_275573924.1 NZ_CP119223:1663411-1663800 [Acinetobacter proteolyticus]
MANSAFELQYSRFALVLQLLLFLFIVGLVYSLVTFWWWLLSFAMMTIAWLSFLRQPQIRRFEYLDHQDCSFEFSDPTLKI
QRRQIVKILDHQLYIALYFSHKKHKPCIIWRDQLSHSQWKKLKVHAKLS
MANSAFELQYSRFALVLQLLLFLFIVGLVYSLVTFWWWLLSFAMMTIAWLSFLRQPQIRRFEYLDHQDCSFEFSDPTLKI
QRRQIVKILDHQLYIALYFSHKKHKPCIIWRDQLSHSQWKKLKVHAKLS
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|