Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1082655..1083262 | Replicon | chromosome |
Accession | NZ_CP119223 | ||
Organism | Acinetobacter proteolyticus strain AP54 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1E7QXN7 |
Locus tag | PY247_RS05085 | Protein ID | WP_070076683.1 |
Coordinates | 1082655..1083074 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PY247_RS05090 | Protein ID | WP_275574143.1 |
Coordinates | 1083074..1083262 (-) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY247_RS05050 (PY247_05050) | 1078295..1078998 | - | 704 | Protein_975 | DUF1003 domain-containing protein | - |
PY247_RS05055 (PY247_05055) | 1079118..1079357 | - | 240 | WP_159413965.1 | hypothetical protein | - |
PY247_RS05060 (PY247_05060) | 1079492..1080193 | - | 702 | WP_275573734.1 | hypothetical protein | - |
PY247_RS05065 (PY247_05065) | 1080318..1081016 | - | 699 | WP_275573735.1 | hypothetical protein | - |
PY247_RS05070 (PY247_05070) | 1081081..1081599 | - | 519 | WP_275573736.1 | GNAT family N-acetyltransferase | - |
PY247_RS05075 (PY247_05075) | 1081678..1082253 | - | 576 | WP_070076682.1 | DUF4126 domain-containing protein | - |
PY247_RS05080 (PY247_05080) | 1082381..1082524 | - | 144 | WP_004637424.1 | zinc ribbon-containing protein | - |
PY247_RS05085 (PY247_05085) | 1082655..1083074 | - | 420 | WP_070076683.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PY247_RS05090 (PY247_05090) | 1083074..1083262 | - | 189 | WP_275574143.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PY247_RS05095 (PY247_05095) | 1083534..1086153 | - | 2620 | Protein_984 | Fe/S-dependent 2-methylisocitrate dehydratase AcnD | - |
PY247_RS05100 (PY247_05100) | 1086153..1087309 | - | 1157 | Protein_985 | 2-methylcitrate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15888.03 Da Isoelectric Point: 6.3296
>T273920 WP_070076683.1 NZ_CP119223:c1083074-1082655 [Acinetobacter proteolyticus]
MQTQYLLDTNICIYISKHQPENVRQHFEKHLPNRNILISVVTLGELRFGAEKSQSKGKALKVIDEFTSMIQVAELDEDVA
DHYAQIRQALSSQGQIIGSNDLWLAAHARANNWVMVTNNEKEFLRVDGLRVENWVSTPL
MQTQYLLDTNICIYISKHQPENVRQHFEKHLPNRNILISVVTLGELRFGAEKSQSKGKALKVIDEFTSMIQVAELDEDVA
DHYAQIRQALSSQGQIIGSNDLWLAAHARANNWVMVTNNEKEFLRVDGLRVENWVSTPL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|