Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 3121435..3121970 | Replicon | chromosome |
Accession | NZ_CP119199 | ||
Organism | Mycolicibacterium vanbaalenii strain L1I3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A1T986 |
Locus tag | PXR06_RS14860 | Protein ID | WP_011780141.1 |
Coordinates | 3121435..3121767 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PXR06_RS14865 | Protein ID | WP_041306533.1 |
Coordinates | 3121764..3121970 (-) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXR06_RS14840 | 3117529..3119001 | + | 1473 | WP_275572501.1 | hypothetical protein | - |
PXR06_RS14845 | 3119249..3119746 | + | 498 | WP_275572502.1 | YaeQ family protein | - |
PXR06_RS14850 | 3119819..3120957 | + | 1139 | WP_100522050.1 | IS3 family transposase | - |
PXR06_RS14855 | 3121071..3121256 | - | 186 | WP_208676593.1 | hypothetical protein | - |
PXR06_RS14860 | 3121435..3121767 | - | 333 | WP_011780141.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PXR06_RS14865 | 3121764..3121970 | - | 207 | WP_041306533.1 | DUF3018 family protein | Antitoxin |
PXR06_RS14870 | 3122290..3122940 | - | 651 | WP_275572503.1 | TIGR03086 family metal-binding protein | - |
PXR06_RS14875 | 3123004..3123951 | + | 948 | WP_036372912.1 | WYL domain-containing protein | - |
PXR06_RS14880 | 3124082..3124774 | - | 693 | WP_011780145.1 | WYL domain-containing protein | - |
PXR06_RS14885 | 3124796..3125200 | - | 405 | WP_036372910.1 | nuclear transport factor 2 family protein | - |
PXR06_RS14890 | 3125429..3126225 | + | 797 | Protein_2959 | LLM class F420-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3108683..3131166 | 22483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11972.85 Da Isoelectric Point: 8.7573
>T273919 WP_011780141.1 NZ_CP119199:c3121767-3121435 [Mycolicibacterium vanbaalenii]
VNRGEIWTVAGGVYAAKPRPAVIVQDDLFDATSSVTVAPMTSTLLDAPLMRIRIAGGDGRLSGLDHDRDVMIDKLTTVRR
SNVHVRVGRLTAEQVVEVERTMMAFLGLAR
VNRGEIWTVAGGVYAAKPRPAVIVQDDLFDATSSVTVAPMTSTLLDAPLMRIRIAGGDGRLSGLDHDRDVMIDKLTTVRR
SNVHVRVGRLTAEQVVEVERTMMAFLGLAR
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|