Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 1701865..1702445 | Replicon | chromosome |
Accession | NZ_CP119199 | ||
Organism | Mycolicibacterium vanbaalenii strain L1I3 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A1T5K1 |
Locus tag | PXR06_RS08130 | Protein ID | WP_011778876.1 |
Coordinates | 1701865..1702251 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A2S8LB97 |
Locus tag | PXR06_RS08135 | Protein ID | WP_036369753.1 |
Coordinates | 1702248..1702445 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXR06_RS08115 | 1697096..1698511 | + | 1416 | WP_041305954.1 | NAD(P)H-quinone dehydrogenase | - |
PXR06_RS08120 | 1698691..1700448 | + | 1758 | WP_011778874.1 | glycerol-3-phosphate dehydrogenase/oxidase | - |
PXR06_RS08125 | 1700445..1701302 | + | 858 | WP_275572190.1 | pseudouridine synthase | - |
PXR06_RS08130 | 1701865..1702251 | - | 387 | WP_011778876.1 | Fic family protein | Toxin |
PXR06_RS08135 | 1702248..1702445 | - | 198 | WP_036369753.1 | hypothetical protein | Antitoxin |
PXR06_RS08140 | 1702727..1703008 | + | 282 | WP_275572541.1 | RNA-binding protein | - |
PXR06_RS08145 | 1703008..1703778 | + | 771 | WP_275572191.1 | SDR family oxidoreductase | - |
PXR06_RS08150 | 1703857..1704636 | - | 780 | WP_222880557.1 | enoyl-CoA hydratase-related protein | - |
PXR06_RS08155 | 1704647..1705315 | - | 669 | WP_011778880.1 | TetR family transcriptional regulator | - |
PXR06_RS08160 | 1705385..1706425 | + | 1041 | WP_275572192.1 | ferredoxin reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13754.44 Da Isoelectric Point: 4.1262
>T273918 WP_011778876.1 NZ_CP119199:c1702251-1701865 [Mycolicibacterium vanbaalenii]
VTEYLDRDDVLTAGSAAVGQVVHVSDYGLLDAAVARPRATVFGLDAYPDNFTKAAALLQSLARNHALVDGNMPMAWAAAW
IFLHINGISLGEFDVDDAEVFMNNVAINGDLEIDYVANKLNSYAKPAQ
VTEYLDRDDVLTAGSAAVGQVVHVSDYGLLDAAVARPRATVFGLDAYPDNFTKAAALLQSLARNHALVDGNMPMAWAAAW
IFLHINGISLGEFDVDDAEVFMNNVAINGDLEIDYVANKLNSYAKPAQ
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A1T5K1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S8LB97 |