Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1216268..1216905 | Replicon | chromosome |
Accession | NZ_CP119199 | ||
Organism | Mycolicibacterium vanbaalenii strain L1I3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PXR06_RS05820 | Protein ID | WP_036370257.1 |
Coordinates | 1216510..1216905 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PXR06_RS05815 | Protein ID | WP_036370259.1 |
Coordinates | 1216268..1216513 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXR06_RS05795 | 1212088..1212627 | + | 540 | WP_036370267.1 | YceI family protein | - |
PXR06_RS05800 | 1212678..1214267 | - | 1590 | WP_222880245.1 | MFS transporter | - |
PXR06_RS05805 | 1214271..1215284 | - | 1014 | WP_036370263.1 | TIGR03617 family F420-dependent LLM class oxidoreductase | - |
PXR06_RS05810 | 1215307..1215915 | - | 609 | WP_275572042.1 | TetR/AcrR family transcriptional regulator | - |
PXR06_RS05815 | 1216268..1216513 | + | 246 | WP_036370259.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PXR06_RS05820 | 1216510..1216905 | + | 396 | WP_036370257.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PXR06_RS05825 | 1216979..1220341 | - | 3363 | WP_275572043.1 | SbcC/MukB-like Walker B domain-containing protein | - |
PXR06_RS05830 | 1220334..1221023 | - | 690 | WP_011778442.1 | DUF4194 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14205.00 Da Isoelectric Point: 4.5288
>T273917 WP_036370257.1 NZ_CP119199:1216510-1216905 [Mycolicibacterium vanbaalenii]
MIADSSAIIAILRDEDDAVDYARAVAAADVRRLSAASYLECGIVLDAQRDPVVSRALDELIDEAAMTIEPVTERQAKLAR
RAYAEFGRGSGHPARLNFGDCLSYALALDRREPLLWKGNDFGHTGIASALE
MIADSSAIIAILRDEDDAVDYARAVAAADVRRLSAASYLECGIVLDAQRDPVVSRALDELIDEAAMTIEPVTERQAKLAR
RAYAEFGRGSGHPARLNFGDCLSYALALDRREPLLWKGNDFGHTGIASALE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|