Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 4820437..4821004 | Replicon | chromosome |
Accession | NZ_CP119182 | ||
Organism | Streptomyces caniscabiei strain ID03-3A |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | IHE65_RS21275 | Protein ID | WP_192361290.1 |
Coordinates | 4820437..4820718 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | IHE65_RS21280 | Protein ID | WP_225615251.1 |
Coordinates | 4820723..4821004 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHE65_RS21255 (IHE65_21255) | 4815584..4816483 | + | 900 | WP_192361284.1 | hypothetical protein | - |
IHE65_RS21260 (IHE65_21260) | 4816528..4817151 | - | 624 | WP_086786730.1 | hypothetical protein | - |
IHE65_RS21265 (IHE65_21265) | 4817851..4818783 | + | 933 | WP_192361286.1 | ester cyclase | - |
IHE65_RS21270 (IHE65_21270) | 4818816..4820342 | - | 1527 | WP_192361288.1 | SDR family oxidoreductase | - |
IHE65_RS21275 (IHE65_21275) | 4820437..4820718 | - | 282 | WP_192361290.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
IHE65_RS21280 (IHE65_21280) | 4820723..4821004 | - | 282 | WP_225615251.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
IHE65_RS21285 (IHE65_21285) | 4821395..4822522 | + | 1128 | WP_192361292.1 | substrate-binding domain-containing protein | - |
IHE65_RS21290 (IHE65_21290) | 4822626..4823402 | + | 777 | WP_275874956.1 | ATP-binding cassette domain-containing protein | - |
IHE65_RS21295 (IHE65_21295) | 4823492..4824697 | + | 1206 | WP_192332555.1 | sugar ABC transporter permease | - |
IHE65_RS21300 (IHE65_21300) | 4824746..4825351 | - | 606 | WP_086805202.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10788.57 Da Isoelectric Point: 10.6613
>T273914 WP_192361290.1 NZ_CP119182:c4820718-4820437 [Streptomyces caniscabiei]
MGYVTRFTPHAQRDMLKVPRPDALRILYRLAELQKAMDAGDTESFDIKALKGHSARWRFRVGDYRVVYTVEGGRLIVWVL
AVGNRREICRQVP
MGYVTRFTPHAQRDMLKVPRPDALRILYRLAELQKAMDAGDTESFDIKALKGHSARWRFRVGDYRVVYTVEGGRLIVWVL
AVGNRREICRQVP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|