Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 93332..93857 | Replicon | plasmid p5 |
| Accession | NZ_CP119179 | ||
| Organism | Klebsiella pneumoniae strain X-CRHVKP-130 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | PY995_RS29060 | Protein ID | WP_001159871.1 |
| Coordinates | 93552..93857 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | PY995_RS29055 | Protein ID | WP_000813634.1 |
| Coordinates | 93332..93550 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY995_RS29030 (88663) | 88663..88953 | + | 291 | WP_000648897.1 | hypothetical protein | - |
| PY995_RS29035 (89526) | 89526..90527 | + | 1002 | WP_000785695.1 | DUF4238 domain-containing protein | - |
| PY995_RS29040 (90701) | 90701..91045 | - | 345 | WP_000792769.1 | hypothetical protein | - |
| PY995_RS29045 (91543) | 91543..91797 | - | 255 | WP_000678528.1 | hypothetical protein | - |
| PY995_RS29050 (91847) | 91847..92773 | - | 927 | WP_001290414.1 | hypothetical protein | - |
| PY995_RS29055 (93332) | 93332..93550 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PY995_RS29060 (93552) | 93552..93857 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PY995_RS29065 (93858) | 93858..94292 | + | 435 | Protein_107 | tyrosine-type recombinase/integrase | - |
| PY995_RS29070 (94357) | 94357..95061 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PY995_RS29075 (95113) | 95113..95850 | - | 738 | Protein_109 | conjugal transfer protein TraB | - |
| PY995_RS29080 (95850) | 95850..96578 | - | 729 | WP_001230787.1 | type-F conjugative transfer system secretin TraK | - |
| PY995_RS29085 (96565) | 96565..97131 | - | 567 | WP_000399794.1 | type IV conjugative transfer system protein TraE | - |
| PY995_RS29090 (97153) | 97153..97464 | - | 312 | WP_000012106.1 | type IV conjugative transfer system protein TraL | - |
| PY995_RS29095 (97479) | 97479..97844 | - | 366 | WP_021519752.1 | type IV conjugative transfer system pilin TraA | - |
| PY995_RS29100 (97878) | 97878..98105 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 | - | 1..127419 | 127419 | |
| - | flank | IS/Tn | - | - | 94357..95061 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T273909 WP_001159871.1 NZ_CP119179:93552-93857 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |