Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 7689..8248 Replicon plasmid p5
Accession NZ_CP119179
Organism Klebsiella pneumoniae strain X-CRHVKP-130

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag PY995_RS28580 Protein ID WP_000421257.1
Coordinates 7689..7964 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag PY995_RS28585 Protein ID WP_001178089.1
Coordinates 7964..8248 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY995_RS28545 (2868) 2868..4259 - 1392 WP_000085084.1 SIR2 family protein -
PY995_RS28550 (4336) 4336..4860 - 525 WP_050195267.1 recombinase family protein -
PY995_RS28555 (4885) 4885..5589 + 705 WP_001067845.1 IS6-like element IS26 family transposase -
PY995_RS28560 (5676) 5676..6023 - 348 WP_000142451.1 DUF6404 family protein -
PY995_RS28565 (6152) 6152..6487 + 336 WP_001080730.1 colicin 1A immunity protein -
PY995_RS28570 (6509) 6509..6877 - 369 Protein_8 colicin-like pore-forming protein -
PY995_RS28575 (6942) 6942..7639 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
PY995_RS28580 (7689) 7689..7964 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PY995_RS28585 (7964) 7964..8248 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
PY995_RS28590 (8892) 8892..9896 - 1005 WP_021546935.1 IS110-like element IS4321 family transposase -
PY995_RS28595 (10086) 10086..10790 - 705 WP_001067845.1 IS6-like element IS26 family transposase -
PY995_RS28600 (11071) 11071..11631 + 561 WP_001161490.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaSHV-12 - 1..127419 127419
- inside IScluster/Tn blaSHV-12 - 4885..23579 18694


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T273908 WP_000421257.1 NZ_CP119179:c7964-7689 [Klebsiella pneumoniae]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT273908 WP_001178089.1 NZ_CP119179:c8248-7964 [Klebsiella pneumoniae]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References