Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 220667..221337 Replicon plasmid p4
Accession NZ_CP119178
Organism Klebsiella pneumoniae strain X-CRHVKP-130

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag PY995_RS28465 Protein ID WP_004213072.1
Coordinates 220667..221110 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag PY995_RS28470 Protein ID WP_004213073.1
Coordinates 221107..221337 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY995_RS28430 (216078) 216078..216353 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
PY995_RS28435 (216416) 216416..216907 + 492 WP_011251327.1 DM13 domain-containing protein -
PY995_RS28440 (216956) 216956..217876 + 921 WP_004213934.1 DUF1471 domain-containing protein -
PY995_RS28445 (217967) 217967..218370 + 404 Protein_264 GAF domain-containing protein -
PY995_RS28450 (218888) 218888..219523 - 636 Protein_265 mucoid phenotype regulator RmpA2 -
PY995_RS28455 (219940) 219940..220244 + 305 Protein_266 transposase -
PY995_RS28460 (220267) 220267..220518 - 252 WP_186987481.1 hypothetical protein -
PY995_RS28465 (220667) 220667..221110 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
PY995_RS28470 (221107) 221107..221337 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PY995_RS28475 (221945) 221945..223078 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
PY995_RS28480 (223094) 223094..223387 + 294 WP_004213076.1 hypothetical protein -
PY995_RS28485 (223377) 223377..223583 - 207 WP_004213077.1 hypothetical protein -
PY995_RS28490 (223935) 223935..224225 + 291 WP_004213078.1 hypothetical protein -
PY995_RS28495 (224215) 224215..225114 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cmlA1 / qacE / blaCTX-M-14 / blaKPC-2 / blaTEM-1B iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..232058 232058


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T273907 WP_004213072.1 NZ_CP119178:c221110-220667 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT273907 WP_004213073.1 NZ_CP119178:c221337-221107 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References