Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 181002..181912 Replicon plasmid p4
Accession NZ_CP119178
Organism Klebsiella pneumoniae strain X-CRHVKP-130

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag PY995_RS28220 Protein ID WP_004026354.1
Coordinates 181002..181472 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag PY995_RS28225 Protein ID WP_004026357.1
Coordinates 181469..181912 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY995_RS28195 (176414) 176414..176812 - 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -
PY995_RS28200 (177149) 177149..177643 - 495 WP_004212794.1 thermonuclease family protein -
PY995_RS28205 (177821) 177821..178087 + 267 WP_223175074.1 DUF1173 family protein -
PY995_RS28210 (178120) 178120..178770 + 651 WP_068893702.1 DUF1173 family protein -
PY995_RS28220 (181002) 181002..181472 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
PY995_RS28225 (181469) 181469..181912 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
PY995_RS28230 (182013) 182013..182516 - 504 Protein_221 DUF4113 domain-containing protein -
PY995_RS28235 (182722) 182722..183702 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
PY995_RS28240 (183768) 183768..185075 + 1308 Protein_223 FepA family TonB-dependent siderophore receptor -
PY995_RS28245 (185137) 185137..185358 + 222 WP_004213615.1 hypothetical protein -
PY995_RS28250 (185501) 185501..186403 - 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
PY995_RS28255 (186476) 186476..186877 - 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cmlA1 / qacE / blaCTX-M-14 / blaKPC-2 / blaTEM-1B iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..232058 232058
- inside IScluster/Tn - - 151660..183702 32042


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T273906 WP_004026354.1 NZ_CP119178:c181472-181002 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT273906 WP_004026357.1 NZ_CP119178:c181912-181469 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References