Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 10133..10692 Replicon plasmid p4
Accession NZ_CP119178
Organism Klebsiella pneumoniae strain X-CRHVKP-130

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag PY995_RS27185 Protein ID WP_000421257.1
Coordinates 10133..10408 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag PY995_RS27190 Protein ID WP_001178089.1
Coordinates 10408..10692 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY995_RS27150 (5312) 5312..6703 - 1392 WP_000085084.1 SIR2 family protein -
PY995_RS27155 (6780) 6780..7304 - 525 WP_050195267.1 recombinase family protein -
PY995_RS27160 (7329) 7329..8033 + 705 WP_001067845.1 IS6-like element IS26 family transposase -
PY995_RS27165 (8120) 8120..8467 - 348 WP_000142451.1 DUF6404 family protein -
PY995_RS27170 (8596) 8596..8931 + 336 WP_001080730.1 colicin 1A immunity protein -
PY995_RS27175 (8953) 8953..9321 - 369 Protein_10 colicin-like pore-forming protein -
PY995_RS27180 (9386) 9386..10083 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
PY995_RS27185 (10133) 10133..10408 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PY995_RS27190 (10408) 10408..10692 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
PY995_RS27195 (11336) 11336..12340 - 1005 WP_021546935.1 IS110-like element IS4321 family transposase -
PY995_RS27200 (12530) 12530..13234 - 705 WP_001067845.1 IS6-like element IS26 family transposase -
PY995_RS27205 (13298) 13298..13534 - 237 Protein_16 DUF3330 domain-containing protein -
PY995_RS27210 (13737) 13737..14750 - 1014 WP_000845048.1 class 1 integron integrase IntI1 -
PY995_RS27215 (14930) 14930..15484 + 555 WP_032488579.1 aminoglycoside N-acetyltransferase AAC(6')-Ib3 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cmlA1 / qacE / blaCTX-M-14 / blaKPC-2 / blaTEM-1B iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..232058 232058
- inside IScluster/Tn cmlA1 / qacE / blaCTX-M-14 / blaKPC-2 / blaTEM-1B - 31..43200 43169


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T273900 WP_000421257.1 NZ_CP119178:c10408-10133 [Klebsiella pneumoniae]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT273900 WP_001178089.1 NZ_CP119178:c10692-10408 [Klebsiella pneumoniae]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References