Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4106871..4107490 Replicon chromosome
Accession NZ_CP119174
Organism Klebsiella pneumoniae strain X-CRHVKP-130

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PY995_RS20400 Protein ID WP_002892050.1
Coordinates 4107272..4107490 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PY995_RS20395 Protein ID WP_002892066.1
Coordinates 4106871..4107245 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY995_RS20385 (PY995_20385) 4102023..4103216 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PY995_RS20390 (PY995_20390) 4103239..4106385 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
PY995_RS20395 (PY995_20395) 4106871..4107245 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PY995_RS20400 (PY995_20400) 4107272..4107490 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PY995_RS20405 (PY995_20405) 4107649..4108215 + 567 WP_002892030.1 maltose O-acetyltransferase -
PY995_RS20410 (PY995_20410) 4108187..4108327 - 141 WP_004147370.1 hypothetical protein -
PY995_RS20415 (PY995_20415) 4108348..4108818 + 471 WP_002892026.1 YlaC family protein -
PY995_RS20420 (PY995_20420) 4108793..4110244 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PY995_RS20425 (PY995_20425) 4110345..4111043 + 699 WP_002892021.1 GNAT family protein -
PY995_RS20430 (PY995_20430) 4111040..4111180 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PY995_RS20435 (PY995_20435) 4111180..4111443 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273895 WP_002892050.1 NZ_CP119174:4107272-4107490 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273895 WP_002892066.1 NZ_CP119174:4106871-4107245 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References