Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4106871..4107490 | Replicon | chromosome |
| Accession | NZ_CP119174 | ||
| Organism | Klebsiella pneumoniae strain X-CRHVKP-130 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | PY995_RS20400 | Protein ID | WP_002892050.1 |
| Coordinates | 4107272..4107490 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | PY995_RS20395 | Protein ID | WP_002892066.1 |
| Coordinates | 4106871..4107245 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY995_RS20385 (PY995_20385) | 4102023..4103216 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PY995_RS20390 (PY995_20390) | 4103239..4106385 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PY995_RS20395 (PY995_20395) | 4106871..4107245 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| PY995_RS20400 (PY995_20400) | 4107272..4107490 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| PY995_RS20405 (PY995_20405) | 4107649..4108215 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| PY995_RS20410 (PY995_20410) | 4108187..4108327 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| PY995_RS20415 (PY995_20415) | 4108348..4108818 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| PY995_RS20420 (PY995_20420) | 4108793..4110244 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| PY995_RS20425 (PY995_20425) | 4110345..4111043 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| PY995_RS20430 (PY995_20430) | 4111040..4111180 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| PY995_RS20435 (PY995_20435) | 4111180..4111443 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273895 WP_002892050.1 NZ_CP119174:4107272-4107490 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT273895 WP_002892066.1 NZ_CP119174:4106871-4107245 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |