Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | sezT-pezT/zeta-HTH_XRE |
Location | 1462576..1463828 | Replicon | chromosome |
Accession | NZ_CP119172 | ||
Organism | Streptococcus macedonicus strain SGM CIP105683 |
Toxin (Protein)
Gene name | sezT | Uniprot ID | A0A380K1G8 |
Locus tag | PY824_RS07700 | Protein ID | WP_039670298.1 |
Coordinates | 1462576..1463352 (-) | Length | 259 a.a. |
Antitoxin (Protein)
Gene name | pezT | Uniprot ID | A0A380K1G9 |
Locus tag | PY824_RS07705 | Protein ID | WP_039670297.1 |
Coordinates | 1463352..1463828 (-) | Length | 159 a.a. |
Genomic Context
Location: 1457783..1458679 (897 bp)
Type: Others
Protein ID: WP_039671041.1
Type: Others
Protein ID: WP_039671041.1
Location: 1458704..1461532 (2829 bp)
Type: Others
Protein ID: WP_258927394.1
Type: Others
Protein ID: WP_258927394.1
Location: 1461577..1461786 (210 bp)
Type: Others
Protein ID: WP_258927395.1
Type: Others
Protein ID: WP_258927395.1
Location: 1461783..1462592 (810 bp)
Type: Others
Protein ID: WP_039670299.1
Type: Others
Protein ID: WP_039670299.1
Location: 1462576..1463352 (777 bp)
Type: Toxin
Protein ID: WP_039670298.1
Type: Toxin
Protein ID: WP_039670298.1
Location: 1463352..1463828 (477 bp)
Type: Antitoxin
Protein ID: WP_039670297.1
Type: Antitoxin
Protein ID: WP_039670297.1
Location: 1463897..1464187 (291 bp)
Type: Others
Protein ID: WP_039670296.1
Type: Others
Protein ID: WP_039670296.1
Location: 1464234..1464623 (390 bp)
Type: Others
Protein ID: WP_039670295.1
Type: Others
Protein ID: WP_039670295.1
Location: 1464620..1464847 (228 bp)
Type: Others
Protein ID: WP_039670294.1
Type: Others
Protein ID: WP_039670294.1
Location: 1464901..1465977 (1077 bp)
Type: Others
Protein ID: WP_039670293.1
Type: Others
Protein ID: WP_039670293.1
Location: 1466017..1466655 (639 bp)
Type: Others
Protein ID: WP_039670292.1
Type: Others
Protein ID: WP_039670292.1
Location: 1466759..1468063 (1305 bp)
Type: Others
Protein ID: WP_099421314.1
Type: Others
Protein ID: WP_099421314.1
Location: 1468194..1468523 (330 bp)
Type: Others
Protein ID: WP_051673287.1
Type: Others
Protein ID: WP_051673287.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY824_RS07680 (PY824_07680) | 1457783..1458679 | - | 897 | WP_039671041.1 | restriction endonuclease | - |
PY824_RS07685 (PY824_07685) | 1458704..1461532 | - | 2829 | WP_258927394.1 | DEAD/DEAH box helicase | - |
PY824_RS07690 (PY824_07690) | 1461577..1461786 | - | 210 | WP_258927395.1 | hypothetical protein | - |
PY824_RS07695 (PY824_07695) | 1461783..1462592 | - | 810 | WP_039670299.1 | SAVED domain-containing protein | - |
PY824_RS07700 (PY824_07700) | 1462576..1463352 | - | 777 | WP_039670298.1 | type II toxin-antitoxin system toxin PezT | Toxin |
PY824_RS07705 (PY824_07705) | 1463352..1463828 | - | 477 | WP_039670297.1 | type II toxin-antitoxin system antitoxin PezA | Antitoxin |
PY824_RS07710 (PY824_07710) | 1463897..1464187 | - | 291 | WP_039670296.1 | hypothetical protein | - |
PY824_RS07715 (PY824_07715) | 1464234..1464623 | - | 390 | WP_039670295.1 | DUF5945 family protein | - |
PY824_RS07720 (PY824_07720) | 1464620..1464847 | - | 228 | WP_039670294.1 | DUF5965 family protein | - |
PY824_RS07725 (PY824_07725) | 1464901..1465977 | - | 1077 | WP_039670293.1 | toprim domain-containing protein | - |
PY824_RS07730 (PY824_07730) | 1466017..1466655 | - | 639 | WP_039670292.1 | hypothetical protein | - |
PY824_RS07735 (PY824_07735) | 1466759..1468063 | - | 1305 | WP_099421314.1 | hypothetical protein | - |
PY824_RS07740 (PY824_07740) | 1468194..1468523 | - | 330 | WP_051673287.1 | DUF5966 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1249269..1483105 | 233836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 259 a.a. Molecular weight: 29327.26 Da Isoelectric Point: 7.0541
>T273884 WP_039670298.1 NZ_CP119172:c1463352-1462576 [Streptococcus macedonicus]
MRLEEFSEAEFQKALQRTIRALTRGKTIPEQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEHLVDELSTQGYHLLIEGTLRTTQVPRKTAQLLRSKGYQVSLAVIGTKPELSYLSTLIRYEE
LYAINPNQARATPKKHHDGIVENLVDNLKELESDKLFDQIQIYQRDRTCIYDSETDEGSAAEVLQECLFGKWSKIEEEML
RVGEGRMREMSKSNGKDA
MRLEEFSEAEFQKALQRTIRALTRGKTIPEQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEHLVDELSTQGYHLLIEGTLRTTQVPRKTAQLLRSKGYQVSLAVIGTKPELSYLSTLIRYEE
LYAINPNQARATPKKHHDGIVENLVDNLKELESDKLFDQIQIYQRDRTCIYDSETDEGSAAEVLQECLFGKWSKIEEEML
RVGEGRMREMSKSNGKDA
Download Length: 777 bp
Antitoxin
Download Length: 159 a.a. Molecular weight: 18289.82 Da Isoelectric Point: 4.4758
>AT273884 WP_039670297.1 NZ_CP119172:c1463828-1463352 [Streptococcus macedonicus]
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSKVSTELIDCICQKFNVSYVDIVGEDKMLTPVEDYQLTLKIE
IIKERGAAILSKLYRYQDSQDIAFDDESNPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVLA
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSKVSTELIDCICQKFNVSYVDIVGEDKMLTPVEDYQLTLKIE
IIKERGAAILSKLYRYQDSQDIAFDDESNPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVLA
Download Length: 477 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A380K1G8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A380K1G9 |