Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4837885..4838501 | Replicon | chromosome |
Accession | NZ_CP119165 | ||
Organism | Citrobacter freundii strain 2075 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | P0S03_RS23565 | Protein ID | WP_003028682.1 |
Coordinates | 4837885..4838259 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | P0S03_RS23570 | Protein ID | WP_043018956.1 |
Coordinates | 4838259..4838501 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0S03_RS23550 (4835388) | 4835388..4836290 | + | 903 | WP_003847898.1 | formate dehydrogenase O subunit beta | - |
P0S03_RS23555 (4836287) | 4836287..4836922 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
P0S03_RS23560 (4836919) | 4836919..4837848 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
P0S03_RS23565 (4837885) | 4837885..4838259 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P0S03_RS23570 (4838259) | 4838259..4838501 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
P0S03_RS23575 (4838706) | 4838706..4839614 | + | 909 | WP_172750447.1 | alpha/beta hydrolase | - |
P0S03_RS23580 (4839765) | 4839765..4840706 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
P0S03_RS23585 (4840751) | 4840751..4841188 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
P0S03_RS23590 (4841185) | 4841185..4842057 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
P0S03_RS23595 (4842051) | 4842051..4842650 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T273882 WP_003028682.1 NZ_CP119165:c4838259-4837885 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |