Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 4683883..4684549 | Replicon | chromosome |
| Accession | NZ_CP119165 | ||
| Organism | Citrobacter freundii strain 2075 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | P0S03_RS22860 | Protein ID | WP_134214823.1 |
| Coordinates | 4684190..4684549 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | P0S03_RS22855 | Protein ID | WP_134214821.1 |
| Coordinates | 4683883..4684200 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0S03_RS22815 (4679171) | 4679171..4679995 | + | 825 | WP_048216971.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| P0S03_RS22820 (4680063) | 4680063..4681286 | + | 1224 | WP_003031639.1 | L-sorbose 1-phosphate reductase | - |
| P0S03_RS22825 (4681288) | 4681288..4682100 | + | 813 | WP_134214817.1 | shikimate 5-dehydrogenase | - |
| P0S03_RS22830 (4682134) | 4682134..4682451 | - | 318 | WP_054527950.1 | CcdB family protein | - |
| P0S03_RS22835 (4682451) | 4682451..4682744 | - | 294 | WP_003844689.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| P0S03_RS22840 (4682841) | 4682841..4683206 | - | 366 | WP_134214819.1 | hypothetical protein | - |
| P0S03_RS22845 (4683338) | 4683338..4683511 | + | 174 | WP_032938222.1 | hypothetical protein | - |
| P0S03_RS22850 (4683582) | 4683582..4683743 | + | 162 | WP_003841416.1 | phage protein | - |
| P0S03_RS22855 (4683883) | 4683883..4684200 | - | 318 | WP_134214821.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P0S03_RS22860 (4684190) | 4684190..4684549 | - | 360 | WP_134214823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P0S03_RS22865 (4684763) | 4684763..4685452 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
| P0S03_RS22870 (4685599) | 4685599..4687230 | - | 1632 | WP_003031618.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13456.53 Da Isoelectric Point: 10.2555
>T273881 WP_134214823.1 NZ_CP119165:c4684549-4684190 [Citrobacter freundii]
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|