Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3886740..3887419 | Replicon | chromosome |
Accession | NZ_CP119165 | ||
Organism | Citrobacter freundii strain 2075 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | P0S03_RS19080 | Protein ID | WP_172750876.1 |
Coordinates | 3887078..3887419 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | P0S03_RS19075 | Protein ID | WP_127791922.1 |
Coordinates | 3886740..3887057 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0S03_RS19030 (3882181) | 3882181..3883002 | + | 822 | WP_172750878.1 | DUF932 domain-containing protein | - |
P0S03_RS19035 (3883220) | 3883220..3883921 | + | 702 | WP_000189410.1 | WYL domain-containing protein | - |
P0S03_RS19040 (3883958) | 3883958..3884194 | + | 237 | WP_001115854.1 | protein YpjK | - |
P0S03_RS19045 (3884194) | 3884194..3884637 | + | 444 | WP_000824224.1 | hypothetical protein | - |
P0S03_RS19050 (3884661) | 3884661..3885128 | + | 468 | WP_001446317.1 | protein YkfB | - |
P0S03_RS19055 (3885205) | 3885205..3885444 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
P0S03_RS19060 (3885542) | 3885542..3886000 | + | 459 | WP_000211838.1 | antirestriction protein | - |
P0S03_RS19065 (3886016) | 3886016..3886492 | + | 477 | WP_172750877.1 | RadC family protein | - |
P0S03_RS19070 (3886501) | 3886501..3886722 | + | 222 | WP_125369006.1 | DUF987 domain-containing protein | - |
P0S03_RS19075 (3886740) | 3886740..3887057 | + | 318 | WP_127791922.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P0S03_RS19080 (3887078) | 3887078..3887419 | + | 342 | WP_172750876.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
P0S03_RS19090 (3888041) | 3888041..3888505 | - | 465 | WP_003843778.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
P0S03_RS19095 (3888698) | 3888698..3890146 | - | 1449 | WP_003838773.1 | EAL domain-containing protein | - |
P0S03_RS19100 (3890488) | 3890488..3890961 | - | 474 | WP_003838775.1 | hypothetical protein | - |
P0S03_RS19105 (3890936) | 3890936..3891667 | - | 732 | WP_016149623.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12946.02 Da Isoelectric Point: 9.6543
>T273879 WP_172750876.1 NZ_CP119165:3887078-3887419 [Citrobacter freundii]
MKTLPATTQRAAKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQPTGLLRQSRNNVVR
MKTLPATTQRAAKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQPTGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|