Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3684842..3685462 | Replicon | chromosome |
Accession | NZ_CP119165 | ||
Organism | Citrobacter freundii strain 2075 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | P0S03_RS18115 | Protein ID | WP_002892050.1 |
Coordinates | 3685244..3685462 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | P0S03_RS18110 | Protein ID | WP_172750282.1 |
Coordinates | 3684842..3685216 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0S03_RS18100 (3679988) | 3679988..3681181 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P0S03_RS18105 (3681204) | 3681204..3684353 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
P0S03_RS18110 (3684842) | 3684842..3685216 | + | 375 | WP_172750282.1 | Hha toxicity modulator TomB | Antitoxin |
P0S03_RS18115 (3685244) | 3685244..3685462 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
P0S03_RS18120 (3685769) | 3685769..3686320 | + | 552 | WP_003835924.1 | maltose O-acetyltransferase | - |
P0S03_RS18125 (3686437) | 3686437..3686907 | + | 471 | WP_003021724.1 | YlaC family protein | - |
P0S03_RS18130 (3686986) | 3686986..3687126 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
P0S03_RS18135 (3687128) | 3687128..3687388 | - | 261 | WP_003835926.1 | type B 50S ribosomal protein L31 | - |
P0S03_RS18140 (3687592) | 3687592..3689130 | + | 1539 | WP_238788035.1 | EAL domain-containing protein | - |
P0S03_RS18145 (3689182) | 3689182..3689535 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
P0S03_RS18150 (3689600) | 3689600..3690229 | - | 630 | WP_016149709.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273878 WP_002892050.1 NZ_CP119165:3685244-3685462 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14471.27 Da Isoelectric Point: 5.5659
>AT273878 WP_172750282.1 NZ_CP119165:3684842-3685216 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRFFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRFFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|