Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2952194..2952784 | Replicon | chromosome |
Accession | NZ_CP119165 | ||
Organism | Citrobacter freundii strain 2075 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A0J1NBD3 |
Locus tag | P0S03_RS14605 | Protein ID | WP_003836692.1 |
Coordinates | 2952194..2952526 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0J1NBD4 |
Locus tag | P0S03_RS14610 | Protein ID | WP_003836694.1 |
Coordinates | 2952527..2952784 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0S03_RS14580 (2947947) | 2947947..2949434 | + | 1488 | WP_003846749.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
P0S03_RS14590 (2949750) | 2949750..2950700 | - | 951 | WP_003846751.1 | HTH-type transcriptional regulator Cbl | - |
P0S03_RS14595 (2950802) | 2950802..2951719 | - | 918 | WP_171859202.1 | nitrogen assimilation transcriptional regulator NAC | - |
P0S03_RS14605 (2952194) | 2952194..2952526 | - | 333 | WP_003836692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P0S03_RS14610 (2952527) | 2952527..2952784 | - | 258 | WP_003836694.1 | hypothetical protein | Antitoxin |
P0S03_RS14615 (2953398) | 2953398..2954483 | + | 1086 | WP_238788026.1 | hypothetical protein | - |
P0S03_RS14620 (2954594) | 2954594..2957296 | + | 2703 | WP_283903329.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2941797..2975059 | 33262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11703.48 Da Isoelectric Point: 8.5572
>T273877 WP_003836692.1 NZ_CP119165:c2952526-2952194 [Citrobacter freundii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD4 |