Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 872331..872985 | Replicon | chromosome |
Accession | NZ_CP119165 | ||
Organism | Citrobacter freundii strain 2075 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | P0S03_RS04315 | Protein ID | WP_003026936.1 |
Coordinates | 872578..872985 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | P0S03_RS04310 | Protein ID | WP_003026938.1 |
Coordinates | 872331..872597 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0S03_RS04285 (867533) | 867533..868966 | - | 1434 | WP_044700805.1 | 6-phospho-beta-glucosidase BglA | - |
P0S03_RS04290 (869087) | 869087..869815 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
P0S03_RS04295 (869868) | 869868..870179 | + | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
P0S03_RS04300 (870342) | 870342..871001 | + | 660 | WP_003026947.1 | hemolysin III family protein | - |
P0S03_RS04305 (871095) | 871095..872075 | - | 981 | WP_119174530.1 | tRNA-modifying protein YgfZ | - |
P0S03_RS04310 (872331) | 872331..872597 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
P0S03_RS04315 (872578) | 872578..872985 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
P0S03_RS04320 (873030) | 873030..873551 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
P0S03_RS04325 (873665) | 873665..874561 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
P0S03_RS04330 (874585) | 874585..875298 | + | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P0S03_RS04335 (875304) | 875304..877037 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T273871 WP_003026936.1 NZ_CP119165:872578-872985 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |