Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 58344..58963 | Replicon | plasmid pCFSAN126951_03 |
Accession | NZ_CP119162 | ||
Organism | Enterococcus faecalis strain GENOMIC22-006 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3H4V2 |
Locus tag | P0D81_RS17030 | Protein ID | WP_000241511.1 |
Coordinates | 58601..58963 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3H5D1 |
Locus tag | P0D81_RS17025 | Protein ID | WP_000245205.1 |
Coordinates | 58344..58607 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D81_RS17005 (53843) | 53843..56761 | + | 2919 | WP_001240982.1 | Tn3 family transposase | - |
P0D81_RS17010 (56874) | 56874..57245 | + | 372 | WP_010717384.1 | IS3 family transposase | - |
P0D81_RS17015 (57270) | 57270..57557 | - | 288 | WP_010778046.1 | hypothetical protein | - |
P0D81_RS17020 (57547) | 57547..58167 | - | 621 | WP_029656234.1 | recombinase family protein | - |
P0D81_RS17025 (58344) | 58344..58607 | + | 264 | WP_000245205.1 | PbsX family transcriptional regulator | Antitoxin |
P0D81_RS17030 (58601) | 58601..58963 | + | 363 | WP_000241511.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P0D81_RS17035 (59028) | 59028..59990 | - | 963 | WP_002367770.1 | LacI family DNA-binding transcriptional regulator | - |
P0D81_RS17040 (59992) | 59992..61431 | - | 1440 | WP_002367771.1 | sucrose-6-phosphate hydrolase | - |
P0D81_RS17045 (61622) | 61622..63553 | + | 1932 | WP_275527570.1 | sucrose-specific PTS transporter subunit IIBC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) | - | 1..70159 | 70159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13585.78 Da Isoelectric Point: 9.6107
>T273868 WP_000241511.1 NZ_CP119162:58601-58963 [Enterococcus faecalis]
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|