Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 16362..16896 Replicon plasmid pCFSAN126951_03
Accession NZ_CP119162
Organism Enterococcus faecalis strain GENOMIC22-006

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag P0D81_RS16770 Protein ID WP_002360769.1
Coordinates 16621..16896 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag P0D81_RS16765 Protein ID WP_002369771.1
Coordinates 16362..16628 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0D81_RS16730 (12220) 12220..13005 + 786 WP_002360778.1 replication-relaxation family protein -
P0D81_RS16735 (13011) 13011..13499 + 489 WP_002412099.1 hypothetical protein -
P0D81_RS16740 (14091) 14091..14357 + 267 WP_010714123.1 hypothetical protein -
P0D81_RS16745 (14390) 14390..14890 + 501 WP_002360775.1 DnaJ domain-containing protein -
P0D81_RS16750 (14903) 14903..15151 + 249 WP_002360773.1 DUF3850 domain-containing protein -
P0D81_RS16755 (15227) 15227..15643 + 417 WP_202464287.1 single-stranded DNA-binding protein -
P0D81_RS16760 (15667) 15667..16251 + 585 WP_002383617.1 thermonuclease family protein -
P0D81_RS16765 (16362) 16362..16628 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
P0D81_RS16770 (16621) 16621..16896 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
P0D81_RS16775 (17701) 17701..17886 + 186 WP_002368099.1 hypothetical protein -
P0D81_RS16780 (17871) 17871..18062 + 192 WP_002383620.1 DpnD/PcfM family protein -
P0D81_RS16785 (18294) 18294..19073 + 780 WP_002383621.1 Cas9 inhibitor AcrIIA9 family protein -
P0D81_RS16790 (19073) 19073..20332 + 1260 WP_002360763.1 PcfJ domain-containing protein -
P0D81_RS16795 (20981) 20981..21709 + 729 WP_002383622.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid erm(B) - 1..70159 70159


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T273863 WP_002360769.1 NZ_CP119162:16621-16896 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT273863 WP_002369771.1 NZ_CP119162:16362-16628 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References