Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-DinJ |
| Location | 2871320..2871854 | Replicon | chromosome |
| Accession | NZ_CP119159 | ||
| Organism | Enterococcus faecalis strain GENOMIC22-006 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R3JX52 |
| Locus tag | P0D81_RS14250 | Protein ID | WP_002360769.1 |
| Coordinates | 2871320..2871595 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | R3H6P0 |
| Locus tag | P0D81_RS14255 | Protein ID | WP_002369771.1 |
| Coordinates | 2871588..2871854 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D81_RS14220 (2866492) | 2866492..2866677 | - | 186 | WP_002358660.1 | hypothetical protein | - |
| P0D81_RS14225 (2866707) | 2866707..2867036 | + | 330 | WP_002358661.1 | LPXTG cell wall anchor domain-containing protein | - |
| P0D81_RS14230 (2867164) | 2867164..2868102 | + | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| P0D81_RS14235 (2868128) | 2868128..2869165 | + | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| P0D81_RS14240 (2869470) | 2869470..2870364 | - | 895 | Protein_2796 | IS256 family transposase | - |
| P0D81_RS14245 (2870485) | 2870485..2871129 | + | 645 | WP_002377952.1 | IS6 family transposase | - |
| P0D81_RS14250 (2871320) | 2871320..2871595 | - | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| P0D81_RS14255 (2871588) | 2871588..2871854 | - | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P0D81_RS14260 (2871965) | 2871965..2872549 | - | 585 | WP_002377949.1 | thermonuclease family protein | - |
| P0D81_RS14265 (2872573) | 2872573..2872989 | - | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| P0D81_RS14270 (2873065) | 2873065..2873313 | - | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| P0D81_RS14275 (2873326) | 2873326..2873826 | - | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| P0D81_RS14280 (2873859) | 2873859..2874125 | - | 267 | WP_002377947.1 | hypothetical protein | - |
| P0D81_RS14285 (2874717) | 2874717..2875205 | - | 489 | WP_010710133.1 | hypothetical protein | - |
| P0D81_RS14290 (2875211) | 2875211..2875804 | - | 594 | WP_002414802.1 | replication-relaxation family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | cylB / cylM / cylM / cylS / cylL / cylR1 / cylR2 / bsh / EF0485 | 2853345..2899712 | 46367 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10732.58 Da Isoelectric Point: 9.6918
>T273861 WP_002360769.1 NZ_CP119159:c2871595-2871320 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AEA7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AED7 |