273861

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 2871320..2871854 Replicon chromosome
Accession NZ_CP119159
Organism Enterococcus faecalis strain GENOMIC22-006

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag P0D81_RS14250 Protein ID WP_002360769.1
Coordinates 2871320..2871595 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag P0D81_RS14255 Protein ID WP_002369771.1
Coordinates 2871588..2871854 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0D81_RS14220 (2866492) 2866492..2866677 - 186 WP_002358660.1 hypothetical protein -
P0D81_RS14225 (2866707) 2866707..2867036 + 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
P0D81_RS14230 (2867164) 2867164..2868102 + 939 WP_002370935.1 2-dehydropantoate 2-reductase -
P0D81_RS14235 (2868128) 2868128..2869165 + 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
P0D81_RS14240 (2869470) 2869470..2870364 - 895 Protein_2796 IS256 family transposase -
P0D81_RS14245 (2870485) 2870485..2871129 + 645 WP_002377952.1 IS6 family transposase -
P0D81_RS14250 (2871320) 2871320..2871595 - 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
P0D81_RS14255 (2871588) 2871588..2871854 - 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
P0D81_RS14260 (2871965) 2871965..2872549 - 585 WP_002377949.1 thermonuclease family protein -
P0D81_RS14265 (2872573) 2872573..2872989 - 417 WP_010710134.1 single-stranded DNA-binding protein -
P0D81_RS14270 (2873065) 2873065..2873313 - 249 WP_002360773.1 DUF3850 domain-containing protein -
P0D81_RS14275 (2873326) 2873326..2873826 - 501 WP_002360775.1 DnaJ domain-containing protein -
P0D81_RS14280 (2873859) 2873859..2874125 - 267 WP_002377947.1 hypothetical protein -
P0D81_RS14285 (2874717) 2874717..2875205 - 489 WP_010710133.1 hypothetical protein -
P0D81_RS14290 (2875211) 2875211..2875804 - 594 WP_002414802.1 replication-relaxation family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - cylB / cylM / cylM / cylS / cylL / cylR1 / cylR2 / bsh / EF0485 2853345..2899712 46367


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T273861 WP_002360769.1 NZ_CP119159:c2871595-2871320 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT273861 WP_002369771.1 NZ_CP119159:c2871854-2871588 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References