Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
Location | 728202..728900 | Replicon | chromosome |
Accession | NZ_CP119159 | ||
Organism | Enterococcus faecalis strain GENOMIC22-006 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | A0A059N529 |
Locus tag | P0D81_RS03610 | Protein ID | WP_002373917.1 |
Coordinates | 728202..728546 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | P0D81_RS03615 | Protein ID | WP_002388206.1 |
Coordinates | 728565..728900 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D81_RS03590 (725438) | 725438..725587 | + | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
P0D81_RS03595 (725690) | 725690..726871 | - | 1182 | WP_002365138.1 | site-specific integrase | - |
P0D81_RS03600 (727026) | 727026..727757 | - | 732 | WP_010706861.1 | potassium channel family protein | - |
P0D81_RS03605 (727775) | 727775..728173 | - | 399 | WP_010706860.1 | hypothetical protein | - |
P0D81_RS03610 (728202) | 728202..728546 | - | 345 | WP_002373917.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
P0D81_RS03615 (728565) | 728565..728900 | - | 336 | WP_002388206.1 | helix-turn-helix transcriptional regulator | Antitoxin |
P0D81_RS03620 (729192) | 729192..729374 | + | 183 | WP_002388205.1 | hypothetical protein | - |
P0D81_RS03625 (729387) | 729387..729725 | + | 339 | WP_010706859.1 | hypothetical protein | - |
P0D81_RS03630 (729788) | 729788..729967 | + | 180 | WP_229202013.1 | DUF2829 domain-containing protein | - |
P0D81_RS03635 (729985) | 729985..730254 | + | 270 | WP_002365131.1 | hypothetical protein | - |
P0D81_RS03640 (730289) | 730289..730459 | + | 171 | WP_010706857.1 | hypothetical protein | - |
P0D81_RS03645 (730460) | 730460..730876 | + | 417 | WP_002417286.1 | hypothetical protein | - |
P0D81_RS03650 (730963) | 730963..731262 | + | 300 | WP_010706856.1 | hypothetical protein | - |
P0D81_RS03655 (731259) | 731259..731483 | + | 225 | WP_002367281.1 | hypothetical protein | - |
P0D81_RS03660 (731486) | 731486..731842 | + | 357 | WP_010706855.1 | hypothetical protein | - |
P0D81_RS03665 (731935) | 731935..732906 | + | 972 | WP_010706854.1 | RecT family recombinase | - |
P0D81_RS03670 (732869) | 732869..733684 | + | 816 | WP_010706853.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 725690..776406 | 50716 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13594.61 Da Isoelectric Point: 5.6177
>T273859 WP_002373917.1 NZ_CP119159:c728546-728202 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|