Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 7433..8040 | Replicon | plasmid pCFSAN126950_01 |
| Accession | NZ_CP119151 | ||
| Organism | Enterococcus faecium strain GENOMIC22-005 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | E3USU0 |
| Locus tag | P0D82_RS14325 | Protein ID | WP_002321032.1 |
| Coordinates | 7690..8040 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A829F3C0 |
| Locus tag | P0D82_RS14320 | Protein ID | WP_002287514.1 |
| Coordinates | 7433..7696 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D82_RS14275 (P0D82_14275) | 2469..3368 | + | 900 | WP_002322787.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| P0D82_RS14280 (P0D82_14280) | 3371..3856 | + | 486 | WP_002296241.1 | single-stranded DNA-binding protein | - |
| P0D82_RS14285 (P0D82_14285) | 4222..4482 | + | 261 | WP_002296240.1 | hypothetical protein | - |
| P0D82_RS14290 (P0D82_14290) | 4923..5129 | + | 207 | WP_002296239.1 | hypothetical protein | - |
| P0D82_RS14295 (P0D82_14295) | 5129..5380 | + | 252 | WP_002296238.1 | hypothetical protein | - |
| P0D82_RS14300 (P0D82_14300) | 5395..5832 | + | 438 | WP_002296237.1 | hypothetical protein | - |
| P0D82_RS14305 (P0D82_14305) | 5825..6532 | + | 708 | WP_002353391.1 | hypothetical protein | - |
| P0D82_RS14310 (P0D82_14310) | 6697..6897 | + | 201 | WP_002330566.1 | hypothetical protein | - |
| P0D82_RS14315 (P0D82_14315) | 6913..7092 | + | 180 | WP_002305761.1 | hypothetical protein | - |
| P0D82_RS14320 (P0D82_14320) | 7433..7696 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
| P0D82_RS14325 (P0D82_14325) | 7690..8040 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P0D82_RS14330 (P0D82_14330) | 8064..8678 | - | 615 | WP_010729795.1 | recombinase family protein | - |
| P0D82_RS14335 (P0D82_14335) | 8992..9414 | + | 423 | WP_002288787.1 | hypothetical protein | - |
| P0D82_RS14340 (P0D82_14340) | 9424..9627 | + | 204 | WP_002299573.1 | hypothetical protein | - |
| P0D82_RS14345 (P0D82_14345) | 9838..10422 | + | 585 | WP_002299575.1 | recombinase family protein | - |
| P0D82_RS14350 (P0D82_14350) | 10611..11291 | - | 681 | WP_002331383.1 | IS6-like element IS1216 family transposase | - |
| P0D82_RS14355 (P0D82_14355) | 11367..12010 | - | 644 | Protein_19 | transposase | - |
| P0D82_RS14360 (P0D82_14360) | 12285..12827 | + | 543 | WP_002298088.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..199975 | 199975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T273841 WP_002321032.1 NZ_CP119151:7690-8040 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F5H8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F3C0 |