Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 7433..8040 Replicon plasmid pCFSAN126950_01
Accession NZ_CP119151
Organism Enterococcus faecium strain GENOMIC22-005

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag P0D82_RS14325 Protein ID WP_002321032.1
Coordinates 7690..8040 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag P0D82_RS14320 Protein ID WP_002287514.1
Coordinates 7433..7696 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0D82_RS14275 (P0D82_14275) 2469..3368 + 900 WP_002322787.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
P0D82_RS14280 (P0D82_14280) 3371..3856 + 486 WP_002296241.1 single-stranded DNA-binding protein -
P0D82_RS14285 (P0D82_14285) 4222..4482 + 261 WP_002296240.1 hypothetical protein -
P0D82_RS14290 (P0D82_14290) 4923..5129 + 207 WP_002296239.1 hypothetical protein -
P0D82_RS14295 (P0D82_14295) 5129..5380 + 252 WP_002296238.1 hypothetical protein -
P0D82_RS14300 (P0D82_14300) 5395..5832 + 438 WP_002296237.1 hypothetical protein -
P0D82_RS14305 (P0D82_14305) 5825..6532 + 708 WP_002353391.1 hypothetical protein -
P0D82_RS14310 (P0D82_14310) 6697..6897 + 201 WP_002330566.1 hypothetical protein -
P0D82_RS14315 (P0D82_14315) 6913..7092 + 180 WP_002305761.1 hypothetical protein -
P0D82_RS14320 (P0D82_14320) 7433..7696 + 264 WP_002287514.1 hypothetical protein Antitoxin
P0D82_RS14325 (P0D82_14325) 7690..8040 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
P0D82_RS14330 (P0D82_14330) 8064..8678 - 615 WP_010729795.1 recombinase family protein -
P0D82_RS14335 (P0D82_14335) 8992..9414 + 423 WP_002288787.1 hypothetical protein -
P0D82_RS14340 (P0D82_14340) 9424..9627 + 204 WP_002299573.1 hypothetical protein -
P0D82_RS14345 (P0D82_14345) 9838..10422 + 585 WP_002299575.1 recombinase family protein -
P0D82_RS14350 (P0D82_14350) 10611..11291 - 681 WP_002331383.1 IS6-like element IS1216 family transposase -
P0D82_RS14355 (P0D82_14355) 11367..12010 - 644 Protein_19 transposase -
P0D82_RS14360 (P0D82_14360) 12285..12827 + 543 WP_002298088.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..199975 199975


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T273841 WP_002321032.1 NZ_CP119151:7690-8040 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT273841 WP_002287514.1 NZ_CP119151:7433-7696 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References