Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 6020732..6021366 | Replicon | chromosome |
Accession | NZ_CP119143 | ||
Organism | Streptomyces sp. VNUA24 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYR72_RS25740 | Protein ID | WP_275457513.1 |
Coordinates | 6020732..6021154 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PYR72_RS25745 | Protein ID | WP_275457514.1 |
Coordinates | 6021151..6021366 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR72_RS25725 (PYR72_25725) | 6017523..6020150 | + | 2628 | WP_275457510.1 | class III lanthionine synthetase LanKC | - |
PYR72_RS25730 (PYR72_25730) | 6020162..6020410 | + | 249 | WP_275457511.1 | hypothetical protein | - |
PYR72_RS25735 (PYR72_25735) | 6020425..6020682 | + | 258 | WP_275457512.1 | hypothetical protein | - |
PYR72_RS25740 (PYR72_25740) | 6020732..6021154 | - | 423 | WP_275457513.1 | PIN domain nuclease | Toxin |
PYR72_RS25745 (PYR72_25745) | 6021151..6021366 | - | 216 | WP_275457514.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PYR72_RS25750 (PYR72_25750) | 6021486..6023912 | - | 2427 | WP_275457515.1 | helicase-associated domain-containing protein | - |
PYR72_RS25755 (PYR72_25755) | 6025333..6025653 | + | 321 | WP_275457516.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15360.24 Da Isoelectric Point: 4.7222
>T273838 WP_275457513.1 NZ_CP119143:c6021154-6020732 [Streptomyces sp. VNUA24]
VNSAQFLIDTSALARFMREDAEQYGWDQAAAAGLIAACPITELEFFYSARSAADRARGIEDMRLIFGWVPVDDRAYDRAW
QVQEALTKQGKHRSAGAVDLVVAATAELQGLTLLHRDHDFACIAAVTGQALQWYGPESGK
VNSAQFLIDTSALARFMREDAEQYGWDQAAAAGLIAACPITELEFFYSARSAADRARGIEDMRLIFGWVPVDDRAYDRAW
QVQEALTKQGKHRSAGAVDLVVAATAELQGLTLLHRDHDFACIAAVTGQALQWYGPESGK
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|