Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1537220..1537905 | Replicon | plasmid p2022NG-0076_1 |
| Accession | NZ_CP119140 | ||
| Organism | Neisseria gonorrhoeae strain 2022NG-0076 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | P0D78_RS08065 | Protein ID | WP_003689143.1 |
| Coordinates | 1537723..1537905 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | P0D78_RS08060 | Protein ID | WP_003691454.1 |
| Coordinates | 1537220..1537621 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D78_RS08005 (P0D78_08005) | 1532254..1532469 | - | 216 | WP_003691538.1 | hypothetical protein | - |
| P0D78_RS08010 (P0D78_08010) | 1532521..1533012 | - | 492 | WP_047918703.1 | siphovirus Gp157 family protein | - |
| P0D78_RS08015 (P0D78_08015) | 1533009..1533191 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| P0D78_RS08020 (P0D78_08020) | 1533331..1534017 | - | 687 | WP_033910330.1 | hypothetical protein | - |
| P0D78_RS08025 (P0D78_08025) | 1534086..1534247 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| P0D78_RS08030 (P0D78_08030) | 1534244..1534519 | - | 276 | WP_010359972.1 | hypothetical protein | - |
| P0D78_RS08035 (P0D78_08035) | 1534672..1535004 | - | 333 | WP_050154664.1 | hypothetical protein | - |
| P0D78_RS08040 (P0D78_08040) | 1535146..1535433 | - | 288 | WP_050154388.1 | hypothetical protein | - |
| P0D78_RS08045 (P0D78_08045) | 1535430..1535906 | - | 477 | WP_002255718.1 | hypothetical protein | - |
| P0D78_RS08050 (P0D78_08050) | 1535939..1536139 | - | 201 | WP_047920246.1 | hypothetical protein | - |
| P0D78_RS08055 (P0D78_08055) | 1536360..1537121 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| P0D78_RS08060 (P0D78_08060) | 1537220..1537621 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P0D78_RS08065 (P0D78_08065) | 1537723..1537905 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P0D78_RS08070 (P0D78_08070) | 1538075..1538893 | - | 819 | WP_012503752.1 | DUF3037 domain-containing protein | - |
| P0D78_RS08075 (P0D78_08075) | 1538890..1539588 | - | 699 | WP_048654307.1 | hypothetical protein | - |
| P0D78_RS08080 (P0D78_08080) | 1539827..1540525 | - | 699 | WP_002212401.1 | S24 family peptidase | - |
| P0D78_RS08085 (P0D78_08085) | 1540565..1541218 | - | 654 | WP_157149898.1 | helix-turn-helix transcriptional regulator | - |
| P0D78_RS08090 (P0D78_08090) | 1541467..1541601 | + | 135 | WP_229684436.1 | YdaS family helix-turn-helix protein | - |
| P0D78_RS08095 (P0D78_08095) | 1541603..1541803 | + | 201 | WP_012503750.1 | hypothetical protein | - |
| P0D78_RS08100 (P0D78_08100) | 1542000..1542806 | + | 807 | WP_276824902.1 | replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | penA | pilQ / pilP / pilO / pilN / pilM / mntC / mntB / mntA / fbpC / fbpB / fbpA / nspA / lbpB / lbpA / iga / iga / recN / pilT2 / pilZ / pilH / pilI / pilJ / pilK / pilX / pilW / kdsA / pilE / hmbR / hmbR / hmbR / mtrE / mtrD / mtrC / pilV / tbpA / pilE / pilG / pilD / pilF / farB / farA / pilE / pilE / pilE / msrA/B / pilE / pilU / pilT / wbtL / tufA / tufA / porB / katA / lpt6 / htpB / luxS / hpuB / hpuA | 1..2168363 | 2168363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T273834 WP_003689143.1 NZ_CP119140:c1537905-1537723 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT273834 WP_003691454.1 NZ_CP119140:c1537621-1537220 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|