Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 961774..962429 | Replicon | plasmid p2022NG-0076_1 |
| Accession | NZ_CP119140 | ||
| Organism | Neisseria gonorrhoeae strain 2022NG-0076 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | P0D78_RS04985 | Protein ID | WP_003691083.1 |
| Coordinates | 961774..962193 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | P0D78_RS04990 | Protein ID | WP_003688410.1 |
| Coordinates | 962193..962429 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D78_RS04965 (P0D78_04965) | 957008..958549 | - | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
| P0D78_RS04970 (P0D78_04970) | 958697..959476 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| P0D78_RS04975 (P0D78_04975) | 959473..960174 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| P0D78_RS04980 (P0D78_04980) | 960171..961625 | + | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| P0D78_RS04985 (P0D78_04985) | 961774..962193 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| P0D78_RS04990 (P0D78_04990) | 962193..962429 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| P0D78_RS04995 (P0D78_04995) | 962877..963455 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
| P0D78_RS05000 (P0D78_05000) | 963460..963750 | - | 291 | WP_041420764.1 | helix-turn-helix domain-containing protein | - |
| P0D78_RS05005 (P0D78_05005) | 964100..964486 | + | 387 | Protein_968 | IS110 family transposase | - |
| P0D78_RS05010 (P0D78_05010) | 964869..965759 | - | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
| P0D78_RS05015 (P0D78_05015) | 965770..966936 | - | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| P0D78_RS05020 (P0D78_05020) | 967008..967295 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | penA | pilQ / pilP / pilO / pilN / pilM / mntC / mntB / mntA / fbpC / fbpB / fbpA / nspA / lbpB / lbpA / iga / iga / recN / pilT2 / pilZ / pilH / pilI / pilJ / pilK / pilX / pilW / kdsA / pilE / hmbR / hmbR / hmbR / mtrE / mtrD / mtrC / pilV / tbpA / pilE / pilG / pilD / pilF / farB / farA / pilE / pilE / pilE / msrA/B / pilE / pilU / pilT / wbtL / tufA / tufA / porB / katA / lpt6 / htpB / luxS / hpuB / hpuA | 1..2168363 | 2168363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T273833 WP_003691083.1 NZ_CP119140:c962193-961774 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|