Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 4635290..4635899 | Replicon | chromosome |
| Accession | NZ_CP119138 | ||
| Organism | Alicyclobacillus fastidiosus strain Alicyclobacillus fastidiosus KKP 3000 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PYS47_RS22760 | Protein ID | WP_268005580.1 |
| Coordinates | 4635290..4635640 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PYS47_RS22765 | Protein ID | WP_268008623.1 |
| Coordinates | 4635645..4635899 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYS47_RS22730 (PYS47_22730) | 4630661..4630879 | - | 219 | WP_275474389.1 | DUF2922 domain-containing protein | - |
| PYS47_RS22735 (PYS47_22735) | 4630926..4631165 | - | 240 | WP_275474390.1 | DUF1659 domain-containing protein | - |
| PYS47_RS22740 (PYS47_22740) | 4631361..4632671 | - | 1311 | WP_275474391.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| PYS47_RS22745 (PYS47_22745) | 4632668..4632997 | - | 330 | WP_275474392.1 | helix-turn-helix transcriptional regulator | - |
| PYS47_RS22750 (PYS47_22750) | 4633178..4633915 | - | 738 | WP_275474393.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| PYS47_RS22755 (PYS47_22755) | 4633932..4635185 | - | 1254 | WP_275474394.1 | adenosylhomocysteinase | - |
| PYS47_RS22760 (PYS47_22760) | 4635290..4635640 | - | 351 | WP_268005580.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYS47_RS22765 (PYS47_22765) | 4635645..4635899 | - | 255 | WP_268008623.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PYS47_RS22770 (PYS47_22770) | 4635999..4637219 | - | 1221 | WP_275474395.1 | alanine racemase | - |
| PYS47_RS22775 (PYS47_22775) | 4637409..4638407 | - | 999 | WP_275477040.1 | outer membrane lipoprotein carrier protein LolA | - |
| PYS47_RS22780 (PYS47_22780) | 4638449..4639933 | - | 1485 | WP_275474396.1 | NAD(P)H-hydrate dehydratase | - |
| PYS47_RS22785 (PYS47_22785) | 4640027..4640404 | - | 378 | WP_275474397.1 | holo-ACP synthase | - |
| PYS47_RS22790 (PYS47_22790) | 4640538..4640726 | + | 189 | WP_275474398.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12843.95 Da Isoelectric Point: 5.6766
>T273832 WP_268005580.1 NZ_CP119138:c4635640-4635290 [Alicyclobacillus fastidiosus]
MNVKRGDVFFADLSPVVGSEQGGFRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIPAQPYGLERDSVVLLEQL
RTLDKQRLTDKITHLDDTMMKMVNDGLLISLGLVDF
MNVKRGDVFFADLSPVVGSEQGGFRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIPAQPYGLERDSVVLLEQL
RTLDKQRLTDKITHLDDTMMKMVNDGLLISLGLVDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|