Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4031255..4031771 | Replicon | chromosome |
Accession | NZ_CP119137 | ||
Organism | Salmonella enterica subsp. enterica serovar Goldcoast isolate Sal02792 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
Locus tag | P0D85_RS20515 | Protein ID | WP_000220577.1 |
Coordinates | 4031255..4031539 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | P0D85_RS20520 | Protein ID | WP_000212724.1 |
Coordinates | 4031529..4031771 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D85_RS20500 (4026467) | 4026467..4028119 | + | 1653 | WP_126524329.1 | alpha,alpha-phosphotrehalase | - |
P0D85_RS20505 (4028528) | 4028528..4030666 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P0D85_RS20510 (4030787) | 4030787..4031251 | + | 465 | WP_031605772.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P0D85_RS20515 (4031255) | 4031255..4031539 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P0D85_RS20520 (4031529) | 4031529..4031771 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P0D85_RS20525 (4031849) | 4031849..4033762 | - | 1914 | WP_140902122.1 | BglG family transcription antiterminator | - |
P0D85_RS20530 (4033779) | 4033779..4034519 | - | 741 | WP_126524331.1 | KDGP aldolase family protein | - |
P0D85_RS20535 (4034516) | 4034516..4035634 | - | 1119 | WP_126524332.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P0D85_RS20540 (4035618) | 4035618..4036751 | - | 1134 | WP_126524333.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T273829 WP_000220577.1 NZ_CP119137:c4031539-4031255 [Salmonella enterica subsp. enterica serovar Goldcoast]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |