Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3344984..3345604 | Replicon | chromosome |
| Accession | NZ_CP119137 | ||
| Organism | Salmonella enterica subsp. enterica serovar Goldcoast isolate Sal02792 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P0D85_RS17385 | Protein ID | WP_001280991.1 |
| Coordinates | 3345386..3345604 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P0D85_RS17380 | Protein ID | WP_000344807.1 |
| Coordinates | 3344984..3345358 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D85_RS17370 (3340123) | 3340123..3341316 | + | 1194 | WP_126524221.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P0D85_RS17375 (3341339) | 3341339..3344488 | + | 3150 | WP_126524222.1 | efflux RND transporter permease AcrB | - |
| P0D85_RS17380 (3344984) | 3344984..3345358 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P0D85_RS17385 (3345386) | 3345386..3345604 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P0D85_RS17390 (3345783) | 3345783..3346334 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| P0D85_RS17395 (3346452) | 3346452..3346922 | + | 471 | WP_126524223.1 | YlaC family protein | - |
| P0D85_RS17400 (3346978) | 3346978..3347118 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P0D85_RS17405 (3347120) | 3347120..3347383 | - | 264 | WP_000801416.1 | type B 50S ribosomal protein L31 | - |
| P0D85_RS17410 (3347608) | 3347608..3349158 | + | 1551 | WP_126524224.1 | EAL domain-containing protein | - |
| P0D85_RS17420 (3349389) | 3349389..3349778 | + | 390 | WP_126524225.1 | MGMT family protein | - |
| P0D85_RS17425 (3349811) | 3349811..3350380 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T273826 WP_001280991.1 NZ_CP119137:3345386-3345604 [Salmonella enterica subsp. enterica serovar Goldcoast]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT273826 WP_000344807.1 NZ_CP119137:3344984-3345358 [Salmonella enterica subsp. enterica serovar Goldcoast]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|