Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1851369..1851959 | Replicon | chromosome |
| Accession | NZ_CP119137 | ||
| Organism | Salmonella enterica subsp. enterica serovar Goldcoast isolate Sal02792 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A3S5G4X7 |
| Locus tag | P0D85_RS09945 | Protein ID | WP_039591092.1 |
| Coordinates | 1851627..1851959 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A3V3TWU4 |
| Locus tag | P0D85_RS09940 | Protein ID | WP_039520052.1 |
| Coordinates | 1851369..1851626 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D85_RS09925 (1848697) | 1848697..1849959 | - | 1263 | WP_206612204.1 | hypothetical protein | - |
| P0D85_RS09930 (1850345) | 1850345..1850818 | + | 474 | WP_126523999.1 | hypothetical protein | - |
| P0D85_RS09935 (1850815) | 1850815..1851021 | + | 207 | WP_268651589.1 | helix-turn-helix transcriptional regulator | - |
| P0D85_RS09940 (1851369) | 1851369..1851626 | + | 258 | WP_039520052.1 | antitoxin | Antitoxin |
| P0D85_RS09945 (1851627) | 1851627..1851959 | + | 333 | WP_039591092.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P0D85_RS09950 (1852792) | 1852792..1853676 | + | 885 | WP_126524002.1 | integrase domain-containing protein | - |
| P0D85_RS09955 (1854706) | 1854706..1855968 | - | 1263 | WP_126524003.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1841605..1851959 | 10354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11765.62 Da Isoelectric Point: 10.5834
>T273821 WP_039591092.1 NZ_CP119137:1851627-1851959 [Salmonella enterica subsp. enterica serovar Goldcoast]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5G4X7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V3TWU4 |