Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 323903..324489 Replicon chromosome
Accession NZ_CP119137
Organism Salmonella enterica subsp. enterica serovar Goldcoast isolate Sal02792

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag P0D85_RS02745 Protein ID WP_000174966.1
Coordinates 324121..324489 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag P0D85_RS02740 Protein ID WP_001535398.1
Coordinates 323903..324124 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0D85_RS02715 (318921) 318921..320030 + 1110 WP_126523776.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P0D85_RS02720 (320092) 320092..321018 + 927 WP_126523777.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P0D85_RS02725 (321015) 321015..322292 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P0D85_RS02730 (322289) 322289..323056 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P0D85_RS02735 (323058) 323058..323771 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P0D85_RS02740 (323903) 323903..324124 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P0D85_RS02745 (324121) 324121..324489 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P0D85_RS02750 (324748) 324748..326064 + 1317 WP_000624749.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P0D85_RS02755 (326169) 326169..327056 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P0D85_RS02760 (327053) 327053..327898 + 846 WP_000572203.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P0D85_RS02765 (327901) 327901..328971 + 1071 WP_001646570.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 321015..329708 8693


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T273818 WP_000174966.1 NZ_CP119137:324121-324489 [Salmonella enterica subsp. enterica serovar Goldcoast]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT273818 WP_001535398.1 NZ_CP119137:323903-324124 [Salmonella enterica subsp. enterica serovar Goldcoast]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References