Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 366221..366752 | Replicon | plasmid unnamed1 |
Accession | NZ_CP119128 | ||
Organism | Sphingobium sp. WTD-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | T0GNF5 |
Locus tag | N6H05_RS26940 | Protein ID | WP_004212690.1 |
Coordinates | 366221..366502 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | T0G968 |
Locus tag | N6H05_RS26945 | Protein ID | WP_004212689.1 |
Coordinates | 366489..366752 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H05_RS26915 (N6H05_26915) | 361740..362147 | + | 408 | WP_016743851.1 | response regulator | - |
N6H05_RS26920 (N6H05_26920) | 362210..363178 | - | 969 | Protein_355 | magnesium/cobalt transporter CorA | - |
N6H05_RS26925 (N6H05_26925) | 363627..364457 | - | 831 | WP_021245217.1 | SDR family oxidoreductase | - |
N6H05_RS26930 (N6H05_26930) | 364527..365093 | + | 567 | WP_062787982.1 | TetR family transcriptional regulator | - |
N6H05_RS26935 (N6H05_26935) | 365301..365873 | - | 573 | WP_284114374.1 | PepSY-associated TM helix domain-containing protein | - |
N6H05_RS26940 (N6H05_26940) | 366221..366502 | - | 282 | WP_004212690.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
N6H05_RS26945 (N6H05_26945) | 366489..366752 | - | 264 | WP_004212689.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N6H05_RS26950 (N6H05_26950) | 367137..367574 | - | 438 | WP_007683347.1 | DUF411 domain-containing protein | - |
N6H05_RS26955 (N6H05_26955) | 367654..368895 | - | 1242 | WP_007683345.1 | MFS transporter | - |
N6H05_RS26960 (N6H05_26960) | 368889..369875 | - | 987 | WP_284114376.1 | copper resistance protein B | - |
N6H05_RS26965 (N6H05_26965) | 369872..371578 | - | 1707 | WP_062788780.1 | copper resistance system multicopper oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | catB3 / dfrB4 | virB11 | 1..449985 | 449985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10993.49 Da Isoelectric Point: 7.4752
>T273811 WP_004212690.1 NZ_CP119128:c366502-366221 [Sphingobium sp. WTD-1]
MRTIERFGRFKRDYKREKKGQHAKTLDADLIPIIEALASDEPLEPRHRDHALTGDWRDHRDCHIKPDLVLIYRKPDDDTL
QLVRLGSHAELGW
MRTIERFGRFKRDYKREKKGQHAKTLDADLIPIIEALASDEPLEPRHRDHALTGDWRDHRDCHIKPDLVLIYRKPDDDTL
QLVRLGSHAELGW
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|